KEGG   Pseudomonas aeruginosa MTB-1: U769_06945Help
Entry
U769_06945        CDS       T02951                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paem  Pseudomonas aeruginosa MTB-1
Pathway
paem00071  Fatty acid degradation
paem00072  Synthesis and degradation of ketone bodies
paem00280  Valine, leucine and isoleucine degradation
paem00310  Lysine degradation
paem00362  Benzoate degradation
paem00380  Tryptophan metabolism
paem00620  Pyruvate metabolism
paem00630  Glyoxylate and dicarboxylate metabolism
paem00640  Propanoate metabolism
paem00650  Butanoate metabolism
paem00900  Terpenoid backbone biosynthesis
paem01100  Metabolic pathways
paem01110  Biosynthesis of secondary metabolites
paem01120  Microbial metabolism in diverse environments
paem01130  Biosynthesis of antibiotics
paem01200  Carbon metabolism
paem01212  Fatty acid metabolism
paem02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paem00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    U769_06945
   00630 Glyoxylate and dicarboxylate metabolism
    U769_06945
   00640 Propanoate metabolism
    U769_06945
   00650 Butanoate metabolism
    U769_06945
  Lipid metabolism
   00071 Fatty acid degradation
    U769_06945
   00072 Synthesis and degradation of ketone bodies
    U769_06945
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    U769_06945
   00310 Lysine degradation
    U769_06945
   00380 Tryptophan metabolism
    U769_06945
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    U769_06945
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    U769_06945
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    U769_06945
Enzymes [BR:paem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     U769_06945
Exosome [BR:paem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   U769_06945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHB54630
UniProt: A0A0E1AR76
Position
1487341..1488546
Genome map
AA seq 401 aa AA seqDB search
MLDAYIYAGLRTPFGRHAGALSTVRPDDLAGLLLARLAETSGFAVDDLEDVILGCTNQAG
EDSRNLARNALLAAGLPARLPGQTVNRLCASGLSAVIDAAHAISCGEGRLYLAGGAESMS
RAPFVMGKAESAFSRTLEVFDSTIGARFANPRLVERYGNDSMPETGDNVARAFGIAREDA
DRFAASSQARYQAALEEGFFLGEILPVEVRAGRKGETRLVERDEHPRPQADLAALARLPA
LFAGGVVTAGNASGINDGAAVVLLGDRAIGEREGIRPLARILASASVGVEPRLMGIGPQQ
AILRALQRAGIDLDEVGLIEINEAFAPQVLACLKLLGLDYEDPRVNPHGGAIALGHPLGA
SGARLVLTAARGLQRIERRYAVVSLCVGLGQGVAMVIERCR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgcctatatctacgccggcctgcgtacgcctttcggccggcatgccggcgca
ctctcgacggtgcgtccggatgacctggccggcctgctgctggcgcgcctcgcggaaacc
tccgggttcgccgtcgacgacctggaggatgtgatcctcggttgcaccaaccaggccggc
gaagacagccgcaacctggcgcgcaacgcgctgctcgcagccggcctgccggcgcggctg
cctgggcagacggtcaaccgcttgtgtgccagcggactgtcggcggtgatcgacgcggcg
cacgcgatcagttgcggcgagggccggctgtacctggccggcggcgccgaaagcatgtcc
cgggcgccgttcgtcatgggcaaggcggagagcgccttcagccgcacgctggaggtcttc
gacagcaccatcggcgcgcgcttcgccaaccccaggctggtcgagcgctatggcaacgac
agcatgccggagaccggcgacaacgtggcccgcgccttcggcatcgcccgcgaggacgcc
gaccgtttcgccgcttcttcccaggcgcgctaccaggctgcgctggaggagggctttttc
ctcggcgagatccttccggtggaggtgcgtgccggacgcaagggcgagacgcggctggtg
gagcgcgacgagcatccgcggccgcaggccgacctggcggccctggcgcgcttgccggcg
ttgttcgccggcggggtagtgaccgccggcaacgcgtcggggatcaacgacggggcggcg
gtagtgctgctgggcgaccgcgcgatcggcgagcgcgagggcatccggccgctggcgcgg
atcctcgccagcgccagcgtcggcgtcgagccccggttgatgggcatcggcccgcagcag
gcgatcctccgcgcgctgcaacgcgccggcatcgacctggacgaggtcggcctgatcgag
atcaacgaagccttcgcgccgcaggtcctggcctgcctgaagttgctcggcctggactac
gaggacccgcgggtcaatccccatggcggcgccattgccctcggccatccgctcggcgcc
tccggtgcgcgcctggtgctcaccgccgcccgcgggctgcaacgcatcgagcggcgctac
gcggtggtcagcctgtgcgtcgggctcggccagggcgtggcgatggtgatcgagcgctgc
cgatga

DBGET integrated database retrieval system