KEGG   Pseudomonas aeruginosa MTB-1: U769_10815Help
Entry
U769_10815        CDS       T02951                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
paem  Pseudomonas aeruginosa MTB-1
Pathway
paem00220  Arginine biosynthesis
paem00250  Alanine, aspartate and glutamate metabolism
paem00290  Valine, leucine and isoleucine biosynthesis
paem01100  Metabolic pathways
paem01110  Biosynthesis of secondary metabolites
paem01130  Biosynthesis of antibiotics
paem01210  2-Oxocarboxylic acid metabolism
paem01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paem00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    U769_10815
   00290 Valine, leucine and isoleucine biosynthesis
    U769_10815
   00220 Arginine biosynthesis
    U769_10815
Enzymes [BR:paem01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     U769_10815
    2.6.1.66  valine---pyruvate transaminase
     U769_10815
Amino acid related enzymes [BR:paem01007]
 Aminotransferase (transaminase)
  Class I
   U769_10815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AHB55399
UniProt: A0A0E1ARH1
Position
complement(2310546..2311757)
Genome map
AA seq 403 aa AA seqDB search
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPEEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGVGIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGKPVHYLCDEQANWWPDLEDIKAKITPNTRAMVIINPNNPT
GAVYSREVLEGMVELARQHNLVLFSDEIYDKILYDGAVHVSTASLAPDVLCLTFNGLSKS
YRVAGFRSGWVAISGPKQRAQSYIEGLDILANMRLCANVPAQHAIQTALGGYQSINDLVL
PPGRLLEQRNRAWELLNDIPGVSCVKPMGALYAFPRIDPKVCPIHNDEKFVLDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEQAILRIGSFLKGYQQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcaaatcgaacaagctcgccaacgtctgctatgacattcgcgggccggtg
ctcaagcacgccaaacgcctagaggaagagggtcaccgcatcctcaagctgaatatcggc
aacccggcgccgttcggtttcgaagctcccgaggaaatcctccaggacgtcatccgcaac
ctgccgaccgcccagggctacagcgactccaagggtctgttcagcgcgcgcaaggcagtg
atgcagtattaccagcagaagcaggtggagggcgtcggcatcgaggacatctacctcggc
aacggcgtgtcggaactgatcgtgatgtccatgcaggcgctgctgaacaacggcgacgag
gtgctgatccccgctcccgactacccgctgtggaccgccgcggtcagcctcgccggcggc
aagccggtgcactacctgtgcgacgagcaggccaactggtggccggacctcgaagacatc
aaggcgaagatcacgccgaacaccagggcgatggtgatcatcaacccgaacaaccccacc
ggcgcggtgtattccagggaagtgctggaaggcatggtcgaactggcccgccagcacaac
ctggtgctgttctccgatgagatctacgacaagatcctctacgacggcgccgtccacgtc
tccaccgcctcgctggcgccggacgtgctctgcctgaccttcaacggcctgtccaaatcc
taccgggtggccggcttccgctccggctgggtggcgatctccgggcccaagcagcgggca
cagagctatatcgaaggtctcgacatcctcgccaacatgcgcctgtgcgccaacgtcccg
gcgcagcacgcgatccagaccgccctgggcggctaccagagcatcaacgatctggtcctg
ccgccggggcgcctgctggagcagcgcaaccgcgcctgggaactgctcaacgacatcccc
ggcgtcagctgcgtgaagccgatgggcgcgctgtacgccttcccgcggatcgacccgaag
gtctgcccgatccacaacgacgagaagttcgtcctcgacctgctgctctcggaaaaactg
ctgatcgtccagggcaccgccttcaactggccgtggcccgaccacttccgggtggtcacc
ctgccccgcgtcgatgacctggagcaggcgatcctgcgcatcggcagcttcctcaagggc
taccagcagtaa

DBGET integrated database retrieval system