KEGG   Pseudomonas aeruginosa MTB-1: U769_15900Help
Entry
U769_15900        CDS       T02951                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
paem  Pseudomonas aeruginosa MTB-1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:paem00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    U769_15900
Enzymes [BR:paem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     U769_15900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3448926..3449852)
Genome map
AA seq 308 aa AA seqDB search
MQAKVLVVGSLNMDLVVRAPRLPRGGETLAGQSFTTIPGGKGANQAVAAARLGAGVAMIG
CLGDDAYGDQLYRALQAEGIDCQGVERVAGESSGVALIVVDDSSQNAIVIVAGGNGHLSP
AVLARHEHLLEQAQVVVCQLESPLETVGHVLRRAHALGKTVILNPAPATRDVPADWLPLV
DYLVPNETESELLCRLPVDSLESAGRAAERLREMGAGRVIVTLGAQGALLVGEGRVEHFP
VARVKALDTTAAGDTFVGGFAAALARGLDEAAAIRFGQAAAAISVTRLGAQTSIPSREEV
ERALAGEA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgaaagtactggtggtgggcagcctgaacatggacctggtggtgcgcgcgccg
cgcctgccacggggcggcgagaccctcgccgggcagtccttcaccaccattcccggcggc
aagggtgccaaccaggcggtcgccgcggcgcgtctcggcgctggggtggcgatgatcggc
tgccttggcgacgatgcctacggcgaccagttgtaccgcgcgctgcaggccgagggcatc
gactgccagggcgtcgagcgggtggccggggagtccagcggggtggcgctgatcgtggtc
gacgacagcagccagaacgccatcgtcatcgtcgccggcggcaacggccacctgtcgccg
gccgtgctggcgcgccacgaacacttgctggagcaggcgcaggtggtggtctgccagctg
gaaagcccgctggagacggttggccatgtgctgcgccgggcccatgcgctgggcaagacg
gtgatcctcaacccggcgccggccacccgcgacgtgccggcggactggctgccgctggtg
gactacctggtccccaacgagaccgaaagcgaactgctctgccgcctgccggtggactcc
ctggagagcgccggacgtgccgccgagcgcctgcgcgaaatgggcgccggcagggtgatc
gtcaccctcggcgcccagggcgccctgctggtgggcgaggggcgggtcgagcatttcccg
gtggcgcgggtcaaggcgctggataccacggcggccggcgacaccttcgtcggtggcttc
gccgcggcccttgcgcgcggcctcgacgaggcggcggcgatccgcttcggccaggccgcc
gcggcgatctcggtgacccgcctcggcgcgcagacctcgatcccctcgcgcgaggaagtc
gagcgggcgctcgctggcgaggcttga

DBGET integrated database retrieval system