KEGG   Pseudomonas aeruginosa MTB-1: U769_25820Help
Entry
U769_25820        CDS       T02951                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
paem  Pseudomonas aeruginosa MTB-1
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:paem00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    U769_25820
Enzymes [BR:paem01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     U769_25820
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     U769_25820
Glycosyltransferases [BR:paem01003]
 Polysaccharide
  Bacterial polysaccharide
   U769_25820
Peptidoglycan biosynthesis and degradation proteins [BR:paem01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   U769_25820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5543815..5546139)
Genome map
AA seq 774 aa AA seqDB search
MTRPRSPRSRNSKARPAPGLNKWLGWALKLGLVGLVLLAGFAIYLDAVVQEKFSGRRWTI
PAKVYARPLELFNGLKLSREDFLRELDALGYRREPSVSGPGTVSVAASAVELNTRGFQFY
EGAEPAQRVRVRFNGNYVSGLSQANGKELAVARLEPLLIGGLYPAHHEDRILVKLDQVPT
YLIDTLVAVEDRDFWNHHGVSLKSVARAVWVNTTAGQLRQGGSTLTQQLVKNFFLSNERS
LSRKINEAMMAVLLELHYDKRDILESYLNEVFLGQDGQRAIHGFGLASQYFFSQPLAELK
LDQVALLVGMVKGPSYFNPRRYPDRALARRNLVLDVLAEQGVATQQEVDAAKQRPLGVTR
QGSMADSSYPAFLDLVKRQLRQDYRDEDLTEEGLRIFTSFDPILQEKAETSVNETLKRLS
GRKGVDQVEAAMVVTNPETGEIQALIGSRDPRFAGFNRALDAVRPIGSLIKPAVYLTALE
RPSKYTLTTWVQDEPFAVKGQDGQVWRPQNYDRRSHGTIFLYQGLANSYNLSTAKLGLDV
GVPNVLQTVARLGINRDWPAYPSMLLGAGSLSPMEVATMYQTIASGGFNTPLRGIRSVLT
ADGQPLKRYPFQVEQRFDSGAVYLVQNAMQRVMREGTGRSVYSQLPSSLTLAGKTGTSND
SRDSWFSGFGGDLQAVVWLGRDDNGKTPLTGATGALQVWASFMRKAHPQSLEMPMPENVV
MAWVDAQTGQGSAADCPNAVQMPYIRGSEPAQGPGCGSQNPAGEVMDWVRGWLN
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtccccgatccccccgttcccgtaacagcaaagcacgcccggcacccggcctg
aacaaatggctcggctgggccctcaagctcggcctcgtcggcctggtgctcctcgccggc
ttcgccatctatctcgatgccgtggtgcaggagaaattctccggccggcgctggaccatc
ccggcgaaggtctatgcccgcccgctggagctgttcaacggcctgaagctgagcagggaa
gacttcctgcgcgaactcgacgccctcggctaccgtcgcgagcccagcgtgagcggccct
ggaaccgtatcggtggcggccagcgcggtcgaactcaatacccgtggcttccagttctac
gaaggcgcggaaccggcccagcgcgtgcgcgtgcgcttcaacggcaactatgtcagcggg
ctgagccaggccaacggcaaggaactggcggtggcgcgccttgagccgctgctgatcggc
ggcttgtatccggcgcaccatgaggatcgcatcctggtcaagctcgaccaggtgccgacc
tacctgatcgacaccctggtcgcggtcgaggatcgcgacttctggaaccaccatggcgtg
tcgctgaaatccgtggcccgggcggtgtgggtcaacaccacggccggccagctgcgccag
ggcggcagcaccctgacccagcagttggtgaagaacttcttcctgagcaatgagcgcagc
ctgagccgcaagatcaacgaagcgatgatggcggtgctgctggaactgcactacgacaag
cgcgacatcctcgagtcctatctcaacgaggtgttcctcggccaggatgggcaacgagcg
atccatggcttcggcctggccagccagtatttcttcagccagccgctggccgagctcaag
ctcgaccaggtggcgctgctggtcggcatggtcaagggaccgtcctacttcaacccgcgg
cgttacccggatcgtgcgctggcgcggcgcaacctggtgctcgacgtgctcgccgagcag
ggcgtggcgacccagcaggaagtcgacgccgccaagcagcgcccgctcggcgttacccgg
cagggcagcatggccgacagctcctatccggccttcctcgacctggtcaagcgccagttg
cgccaggactaccgcgacgaggacctgaccgaggaagggctgcgcatcttcaccagcttc
gatccgatcctgcaggagaaggccgagacctccgtcaacgaaacgctcaagcgcctcagt
gggcgcaagggagtcgaccaggtcgaggcggcgatggtcgtgaccaatccggaaaccggc
gagatccaggccctgatcggcagtcgcgacccgcgcttcgccggcttcaaccgggccctg
gacgcggtgcggccgatcggttcgctgatcaagccggcggtctacctgaccgctctcgag
cggccgagcaagtacaccctgaccacctgggtgcaggacgagcccttcgcggtgaaaggc
caggacggccaggtctggcgaccgcagaactacgaccggcgctcgcatggcacgatcttc
ctgtaccagggcctggcaaactcctacaacctgtccaccgccaagctcggcctcgacgtc
ggtgtgcccaacgtgctgcagaccgtcgcccggctgggtatcaaccgtgactggccggcc
tatccgtcgatgctgctgggcgccggttcgctcagtccgatggaggtcgccaccatgtac
cagaccatcgccagcggcggcttcaacacgccgttgcgggggatccgcagcgtcctcact
gccgacggccagccgctcaagcgctatccgttccaggtcgaacagcgcttcgactcgggc
gccgtctacctggtgcagaacgccatgcagcgggtcatgcgcgaaggcaccgggcgttcg
gtgtacagtcaattgccgtcgtcgctgaccctcgccggcaagaccggcaccagcaacgac
tcgcgcgatagctggttctccggtttcggcggcgacctccaggctgtggtctggctcggt
cgcgacgacaacggcaagacgccgcttaccggcgccaccggtgccttgcaggtgtgggcc
agcttcatgcgcaaggcgcatccgcaatcgctggaaatgccgatgccggagaacgtggtg
atggcctgggtcgacgcgcagaccgggcagggctcggcggcggattgcccgaatgccgta
cagatgccctatattcgtggcagcgagcccgcccagggcccaggctgcgggagccagaac
cccgccggcgaggtgatggactgggtacgtggctggctgaattga

DBGET integrated database retrieval system