KEGG   Pseudomonas aeruginosa PA1: PA1S_gp1801Help
Entry
PA1S_gp1801       CDS       T02928                                 

Definition
Phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:paep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PA1S_gp1801
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PA1S_gp1801
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PA1S_gp1801
Enzymes [BR:paep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PA1S_gp1801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2027689..2029242)
Genome map
AA seq 517 aa AA seqDB search
MDLKRRRVVQGLGAGLLLPALGAPAVIASPRARPKLTDGVQSGDVQGDRALVWSRTDRPA
RMIVEWDTRSVFSEPRRLVSPVTDERLDYTARIDLRGLPADQSIFYRVRFEDARDGSLSK
PWFGHLRSAPSEARNIRFVWSGDTCGQGFGINPDIGGMRIYGAMRRRQPDFFLHSGDTIY
ADGPIPERIETESGRIWRNRVTEAKSKVAETLDEFRGNYRYNLLDDNLRRFNAEVPQIWQ
WDDHETTNNWSSSKQLDERYQVKDIDVLAARARQAFLEYAPLRFQRQGRDGRIYRKVAYG
PLLDVFVLDMRSYRGGNSANLQARRSAATDFLGREQLQWLKRELRGSRAQWKVIAADMPI
GLCVPDGKDAQGRDRWEAIANGNDGAALGRELEIADLLRFVQRAGVRNTVWLTADVHYCA
AHHYSPERAAFKDFAPFWEFVAGPLNAGSFGPNALDGTFGPQVMFQKAPLVQNSSPFAGY
QFFGEVEIDAQSRALTVTLRDLDGEPVFSQELQPDGA
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggacctcaagcgccgccgcgtcgtgcaaggcctgggcgctggactgctgttgccggcg
ctgggcgcgccggcggtgatcgcctcgcccagggcgcggccgaagctgaccgatggcgtg
caatccggcgatgtgcagggcgaccgcgcgctggtctggagccgcaccgaccgcccggcg
cggatgatcgtcgaatgggacacccgtagcgtcttcagcgagccgcgtcggctggtctcg
ccggtcaccgacgagcgcctcgactacaccgcgcgcatcgacctgcgtggcctgccagcc
gaccagtcgatcttctaccgggtgcgcttcgaggatgcccgcgacggcagcctgagcaag
ccctggttcggccacctgcgcagtgcgccgagcgaggcgcgcaatatccgtttcgtctgg
agcggcgacacctgcgggcaaggtttcgggatcaatccggatatcggcggcatgcgtatc
tacggagccatgcgccggcgccagccggatttcttcctgcacagcggcgataccatctat
gccgatgggccgatccccgaacgcatcgagaccgagagcgggcgcatctggcgcaaccgg
gtgaccgaggccaagagcaaggtcgccgagaccctcgacgagttccgcggcaactaccgc
tacaacctgctcgacgacaacctgcgccgcttcaacgccgaggtgccgcagatctggcaa
tgggacgaccacgagaccaccaacaactggtcctccagcaagcagctcgacgagcgctac
caggtgaaggacatcgacgtgctggcggcccgcgcgcgccaggcgttcctcgaatacgcg
ccgctgcgcttccagcgccaggggcgcgatgggcggatctaccgcaaggtcgcctacggc
cctttgctcgacgtgttcgtcctcgacatgcgcagctaccgcggcggcaacagcgccaac
ctgcaggcgcggcgcagcgccgccaccgatttcctcggccgtgaacagttgcaatggctc
aagcgcgagttgcgcggttcgcgcgcgcagtggaaggtgatcgccgccgacatgccgatc
ggcctctgcgtgcccgatggcaaggacgctcagggccgcgaccgctgggaggccatcgcc
aacggcaacgacggcgccgccctcggccgcgagctggagatcgccgatctgctgcgcttc
gtccagcgcgccggggtgcgcaacaccgtctggctgaccgccgacgtgcattactgcgca
gcccaccactacagcccggagcgcgccgcgttcaaggacttcgcgccgttctgggagttc
gtcgccgggcctctcaatgccggtagtttcggacccaacgcgctggatggcacgttcggc
ccgcaggtgatgttccagaaggccccgctggtccagaacagttcccccttcgccggctac
cagttcttcggcgaggtggagatcgatgcgcaaagccgcgcgctcaccgtcaccctgcgc
gacctcgacggcgagccggtgttttcccaggaactgcaacccgacggcgcctga

DBGET integrated database retrieval system