KEGG   Pseudomonas aeruginosa PA1: PA1S_gp5218Help
Entry
PA1S_gp5218       CDS       T02928                                 

Definition
Glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paep00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PA1S_gp5218
   00330 Arginine and proline metabolism
    PA1S_gp5218
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PA1S_gp5218
Enzymes [BR:paep01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     PA1S_gp5218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5805382..5806290
Genome map
AA seq 302 aa AA seqDB search
MQQLLNEILDEVRPLIGRGKVADYIPALAGVEPNQLGIAVYSRDGELFHAGDALRPFSIQ
SISKVFSLVQAIQHSGEDIWQRLGHEPSGQPFNSLVQLEFERGKPRNPFINAGALVICDI
NQSRFAAPAQSMRDFVRRLCGNPEVVSDSVVARSEYQHRSRNAAAAYLMKSFGNFHNDVE
AVLLSYFHHCALRMSCVDLARAFCFLADKGFCKHSGEQVLNERQTKQVNAIMATSGLYDE
AGNFAYRVGLPGKSGVGGGIIAVVPGRFTVCVWSPELNAAGNSLAGIAALEKLSERIGWS
IF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaactgttgaacgagattctcgatgaagtccgcccgctgatcgggcgcggcaag
gtcgccgactacatccccgcgctcgccggcgtcgagccgaaccagctggggatcgccgtg
tacagccgcgacggcgagctgttccatgccggcgacgccctgcggccgttttccatccag
agcatttccaaggtgttcagcctggtccaggcgatccagcattccggcgaggacatctgg
caacgccttggccacgagccctccggccagcctttcaactccctggtgcagctggagttc
gagcgcggcaagccgcgcaacccgttcatcaatgccggcgccctggtgatctgcgacatc
aaccagtcgcgtttcgccgcgccggcgcaatcgatgcgcgatttcgtccggcgtctgtgc
ggcaacccggaagtggtgtcggactcggtggtggcgcgctcggagtaccagcaccgctcg
cgcaacgcggcggcggcctacctgatgaaatcgttcggtaacttccacaacgacgtcgag
gcggtgctgctcagctatttccatcattgcgcgctgcgcatgagctgcgtcgacctggcg
cgggcgttctgcttcctcgccgacaagggcttctgcaagcacagcggcgagcaggtactc
aacgagcggcagaccaagcaggtcaacgcgatcatggccaccagcgggctctacgacgag
gccggcaactttgcctatcgggtcggcctgccgggcaagagcggtgtcggcggcggcatc
atcgcggtagtgccggggcgcttcacggtctgtgtctggtcgccggaactgaacgccgcg
ggcaattcgctggcgggtatcgccgcgctggagaaactcagcgagcggatcggctggtcg
atcttctga

DBGET integrated database retrieval system