KEGG   Pseudomonas aeruginosa PA1: PA1S_gp5617Help
Entry
PA1S_gp5617       CDS       T02928                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:paep00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PA1S_gp5617
Enzymes [BR:paep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PA1S_gp5617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6234351..6235277
Genome map
AA seq 308 aa AA seqDB search
MQAKVLVVGSLNMDLVVRAPRLPRGGETLAGQSFTTIPGGKGANQAVAAARLGAGVAMIG
CLGDDAYGDQLYRALQAEGIDCQGVERVAGESSGVALIVVDDSSQNAIVIVAGGNGHLSP
AVLARHEHLLEQAQVVVCQLESPLETVGHVLRRAHALGKTVILNPAPATRDVPADWLPLV
DYLVPNETESELLCRLPVDSLESAGRAAERLREMGAGRVIVTLGAQGALLVGEGRVEHFP
VARVKALDTTAAGDTFVGGFAAALARGLDEAAAIRFGQAAAAISVTRLGAQTSIPSREEV
ERALAGEA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgaaagtactggtggtgggcagcctgaacatggacctggtagtgcgcgcgccg
cgcctgccacggggcggcgagaccctcgccgggcagtccttcaccaccattcccggcggc
aagggcgccaaccaggcggtcgccgcggcgcgtctcggcgctggggtggcgatgatcggc
tgccttggcgacgatgcctacggcgaccagttgtaccgcgcgctgcaggccgagggcatc
gactgccagggcgtcgagcgggtggccggggagtccagcggggtggcgctgatcgtggtc
gacgacagcagccagaacgccatcgtcatcgtcgccggcggcaacggccacctgtcgccg
gccgtgctggcgcgccacgaacacttgctggagcaggcgcaggtggtggtctgccagctg
gaaagcccgctggagacggttggccatgtgctgcgccgggcccatgcgctgggcaagacg
gtgatcctcaacccggcgccggccacccgcgacgtgccggcggactggctgccgctggtg
gactacctggtccccaacgagaccgaaagcgaactgctctgccgcctgccggtggactcc
ctggagagcgccgggcgtgccgccgagcgcctgcgcgaaatgggcgccggcagggtgatc
gtcaccctcggcgcccagggcgccctgctggtgggcgaggggcgggtcgagcatttcccg
gtggcgcgggtcaaggcgctggataccacggcggccggcgacaccttcgtcggtggcttc
gccgcggcccttgcgcgcggcctcgacgaggcggcggcgatccgtttcggccaggccgcc
gcggcgatctcggtgacccgcctcggcgcgcagacctcgatcccctcgcgcgaggaagtc
gagcgggcgctcgctggcgaggcttga

DBGET integrated database retrieval system