KEGG   Pseudomonas aeruginosa PA1: PA1S_gp5817Help
Entry
PA1S_gp5817       CDS       T02928                                 

Definition
Trehalose synthase (EC:5.4.99.16)
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:paep00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6460024..6463326
Genome map
AA seq 1100 aa AA seqDB search
MARREKPVFLNDPQWYKDAMIYQVHVKSFYDANNDGIGDFAGLIEKLDYIADLGVNTLWL
LPFYPSPRRDDGYDIAQYRGVHSDYGSLADARRFIAEAHRRGLRVITELVINHTSDQHPW
FIRARHAKKGSRARDYYVWSDSDEKYQGTRIIFIDTEQSNWTWDPVAQQYYWHRFYSHQP
DLNFDNPQVLREVLGVMRYWLDMGVDGLRLDAIPYLIERDGTSSENLPETHQVLKRIRAE
LDAHYPDRMLLAEANQWPEDTRPYFGGEDGGEGDECHMAFHFPLMPRMYMAIAQEDRYPI
TDILRQTPDIPANCQWAIFLRNHDELTLEMVTDDERDYLWNHYAADRRARLNLGIRRRLA
PLVERDRRRIELLHSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSVDRNGGF
SRADPAKLVLPPILDPLYGYQTINVEAQARDPHSLLNWMRRLLAVRSQQKAFGRGSLKML
APSNRRILAYLREYAEGERQDSILCVANLSRAAQAVELDLASHAGKVPVEMIGGMSFPPI
GELTYLLTLPPYGFYWFYLADATQMPSWHVAADERLPELPTLVVKQRLGELLQGASRNIL
EGETLPAYLPKRRWFAGEKGQPRLCYIVPLDEAEPRCALCEVEIDGLRYQLPLGFLDADQ
RGDSLPQLLALARLRRGRKVGLLTDAASLPLFARKVLAQLRAEAVIAHGDGEIQFIPAAG
LAEMDDIADEDVLPFSVEQSNSSIRFGERMVLKVLRKILPGLHPEIEVGGYLTRHGYPGI
APLLGEVRRVGADGEPHTLMILQGYLNNQGDAWNWTLDNLERAVRDEISAASEALEGQYD
SLAELRGFAANLGARLGEMHSVLAGESDDPAFGSRESDEANVQAWALRIAEQLREAGKRL
SEPPRPLQGEAAEQARRLLERLPALLERLPLLARQAAGGLLIRVHGDLHLGQVLMVQGDA
RFIDFEGEPARSLEERRQRHSPMKDVGGMLRSFDYAAAMVLRNAQSTDSSEQADSARRKV
AMRYRSEARDAFLAGYRAAAAGLMHAWHGREGEGAALALACLEKAAYELLYEADYRPDWL
EVPLAGLAELTEHLLKGKNR
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atggccagacgcgagaaaccggtctttctcaacgacccgcaatggtacaaggacgcgatg
atctaccaggtccacgtgaaatccttctacgacgccaacaacgatggcatcggcgacttc
gccgggctgatcgagaagctcgactacatcgccgacctcggcgtgaacactctctggctg
ctgccgttctacccgtcgccacgccgcgacgacggctacgacatcgcccagtaccgtggc
gtgcacagcgactacggcagcctcgccgacgcccgccggttcatcgccgaggcccatcga
cgcggtctgcgggtgattaccgagctggtgatcaaccacacctccgaccagcatccctgg
ttcatccgcgcccgccacgcgaagaagggatcgcgcgcccgcgactactacgtctggtcg
gacagcgacgagaaataccagggtacgcggatcatcttcatcgacaccgagcagtccaac
tggacctgggacccggtagcccaacagtactactggcaccgcttctattcccaccagccg
gacctgaacttcgacaacccgcaggtcctgcgcgaggtgctcggggtgatgcgctactgg
ctggacatgggcgtcgacggcttgcgcctggacgcgattccctacctgatcgaacgcgac
ggcaccagcagcgagaacctgccggagacccaccaggtgctcaagcgcatccgcgccgag
ctggacgcgcactatcccgaccgcatgctgctggccgaggccaaccagtggccggaagac
acccggccgtacttcggcggcgaggatggcggcgagggcgacgaatgccacatggccttc
cacttcccgctgatgccgcgcatgtacatggccatcgcccaggaggatcgctatccgatc
accgacatcctgcgccagaccccggacatcccggccaattgccaatgggcgatcttcctg
cgcaaccacgacgagctgaccctggagatggtcaccgacgacgagcgcgactatctctgg
aaccactatgccgccgaccgccgcgcgcgcctcaacctgggcatccgccggcgcctggcg
ccgctggtggagcgtgaccggcggcgcatcgagctgctgcacagcctgctgttgtcgatg
ccgggcacgccgaccctgtactacggcgacgagatcggcatgggcgacaacatctacctc
ggcgaccgcgacggcgtgcggaccccgatgcagtggtcggtggaccgcaacggcggcttc
tcccgcgccgacccggcgaagctggtgctgccgccgatcctcgacccgctgtacggctac
cagacgatcaacgtcgaggcgcaggcgcgcgacccgcattcgctgctcaactggatgcgc
cgcctgctcgccgtgcgcagccagcagaaggccttcggccgcggcagcctgaagatgctc
gcgccgagcaaccgacggatcctcgcctacctgcgcgaatacgccgagggcgaacggcag
gacagcatcctctgcgtggccaacctgtcgcgcgcggcccaggcggtggaactggacctc
gccagccatgccggcaaggtgccggtggagatgatcggcggcatgtcgttcccgccgatc
ggcgagctgacctacctgctgaccctgccgccctacggcttctactggttctacctggcc
gacgcgacgcagatgccgagctggcacgtggccgccgacgagcgcctgccggaactgccg
accctggtggtcaagcagcgcctcggcgagctgctgcagggcgcatcgcggaacatcctg
gaaggcgagacgctgccggcctacctgccgaagcgccgctggttcgccggcgagaaaggc
cagccacggctctgctacatcgttccgctggacgaggcggagccgcgctgtgcgttgtgc
gaagtggagatcgacgggctgcgctaccagttgccgttgggcttcctcgacgccgaccag
cgcggcgacagcctgcctcagttgctggccctggcgcgcctgcggcgcggtcgcaaggtc
ggcctgctgaccgacgccgccagcctgccgctgttcgcccgcaaggtcctcgcgcaactc
cgcgccgaggcggtgatcgcccacggcgacggcgagatccagttcatcccggcggcggga
ctggcggaaatggacgacatcgccgacgaagacgtcctgccgttctcggtggagcagtcc
aacagctcgatccgcttcggcgagcgcatggtcctcaaggtgctgcgcaagatccttccg
gggctgcacccggaaatcgaggtcggcggctacctgacccgccacggctaccccggcatc
gccccgttgctcggcgaggtacggcgggtcggcgcggatggcgagccgcacacgctgatg
atcctgcagggctacctgaacaaccagggcgacgcctggaactggaccctggacaacctg
gagcgagccgtgcgcgacgagatatccgcggccagcgaggcgctcgaagggcaatacgac
agcctcgccgaactgcgcggcttcgccgccaacctcggcgcccggctcggcgagatgcac
agcgtactggccggcgagtcggacgatccggccttcggcagccgcgagagcgacgaagcc
aacgtccaggcctgggcgctgcgcatcgccgaacagttgcgcgaagccggcaaacgcctg
agcgagccgccacggccgttgcagggcgaggcggcggaacaggcgcggcgcctgctggaa
cgcctgccggcgctgctcgaacgcctgccgctgctggcccggcaggcagccggcgggctg
ctgatcagggttcacggcgacctgcacctgggccaggtgctgatggtccagggcgacgca
cgcttcatcgacttcgagggcgagccggcgcgcagcctggaagagcgccgccagcgccac
agtccgatgaaggacgtcggcggcatgctgcgctcgttcgactacgcggcggcgatggtc
ctgcgcaacgcgcagagcaccgatagctcggaacaggccgacagcgcccggcgcaaggtc
gccatgcgctatcgcagcgaagcccgcgatgccttcctggccggctatcgggccgccgcg
gcgggtctcatgcacgcctggcacggtcgcgaaggcgagggggcggcgctggccctggcc
tgcctggaaaaggccgcctacgaactgctctacgaagccgactaccgccccgactggctg
gaagtgcctctcgccggtctggccgaactcaccgaacacctcctgaagggcaagaaccga
tga

DBGET integrated database retrieval system