KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp1132Help
Entry
PA1R_gp1132       CDS       T02929                                 

Definition
Alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
paer  Pseudomonas aeruginosa PA1R
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:paer00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PA1R_gp1132
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PA1R_gp1132
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PA1R_gp1132
Enzymes [BR:paer01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PA1R_gp1132
Exosome [BR:paer04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PA1R_gp1132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1274198..1275628
Genome map
AA seq 476 aa AA seqDB search
MTPGYPLALSLAVSMAVLGSALPAQARQDDPSLFNRQARGELSEYGGARRVEQDLTQALK
QSLSKKKAKNVILLIGDGMGDSEITVARNYARGAGGYFKGIDALPLTGQYTHYSLHKDSG
LPDYVTDSAASATAWTTGVKSYNGAIGVDIHEQPHRNLLELAKLNGKATGNVSTAELQDA
TPAALLAHVTARKCYGPEATSKQCPSNALENGGAGSITEQWLKTRPDVVLGGGAATFAET
AKAGRYAGKTLRAQAEARGYRIVENLDELKAVRRANQKQPLIGLFAPGNMPVRWLGPTAT
YHGNLNQPAVSCEANPKRTADIPTLAQMTSKAIELLKDNPNGFFLQVEGASIDKQDHAAN
PCGQIGETVDLDEAVQKALAFAKADGETLVIVTADHAHSSQIIPPETAAPGLTQLLTTKD
GAPLAISYGNSEEGSQEHTGTQLRIAAYGPQAANVTGLTDQTDLFFTIRRALNLRD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaggttatcccctcgccctctctcttgccgtctccatggccgtgctcggcagc
gccttgccggcccaggcgcgccaggacgatccgtcgctgttcaaccgccaggcccgtggc
gaactcagcgagtacggcggcgcacggcgcgtcgagcaggacctgacccaggccctgaag
cagtcgctgtcgaagaagaaggcgaagaacgtgatcctgctgatcggcgacggcatgggc
gactccgagatcaccgtggcgcgcaactacgcgcgcggcgcgggcggctacttcaagggt
atcgatgcgctgccgctgaccggccagtacacccactactccctgcacaaggacagcggc
ctgccggactacgtgaccgattccgccgcctccgccaccgcctggaccaccggggtcaag
tcgtacaacggcgcgatcggcgtggatatccacgaacagccgcaccgcaacctgctggag
ctggccaagctcaacggcaaggccaccggcaacgtctccaccgccgagctgcaggacgcc
acccccgccgccctgctcgcccacgtcaccgctcgcaagtgctacggtcccgaggccacc
agcaagcagtgcccgagcaatgccctggagaacggcggcgccggctcgatcaccgagcag
tggctgaagacccgccctgacgtggttctcggcggcggcgccgcgaccttcgcggaaacc
gccaaggctggccgctatgccggcaagaccctccgcgcccaggccgaagcccgcggctac
cggatcgtcgagaacctcgacgagctgaaagccgtgcgccgcgccaaccagaagcagccg
ctgatcggcctgttcgcgccgggcaacatgccagtgcgctggctcggtccgaccgccacc
taccacggcaacctgaaccagccggcggtgagctgcgaggcgaacccgaagcgcaccgcc
gacatcccgaccctggcgcaaatgaccagcaaggccatcgagctgctgaaggacaatccg
aacggcttcttcctgcaggtcgagggcgcgtccatcgacaagcaggaccacgccgcgaat
ccgtgcggccagatcggcgagaccgtcgacctcgacgaagccgtgcagaaggccctggcc
ttcgccaaggccgatggcgagaccctggtgatcgtcaccgccgaccacgcccactccagc
cagatcatcccgccggaaaccgccgcgccggggctgacccaactgctcacgaccaaggac
ggcgcgccgctggcgatcagctacggcaactccgaggaaggctcccaggagcacaccggc
acccagttgcgcatcgccgcctacggcccgcaggccgccaatgtcaccggcctgaccgac
cagaccgacctgttcttcaccatccgtcgcgcactgaacctgcgcgactga

DBGET integrated database retrieval system