KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp2702Help
Entry
PA1R_gp2702       CDS       T02929                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paer  Pseudomonas aeruginosa PA1R
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:paer00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PA1R_gp2702
   00630 Glyoxylate and dicarboxylate metabolism
    PA1R_gp2702
   00640 Propanoate metabolism
    PA1R_gp2702
   00650 Butanoate metabolism
    PA1R_gp2702
  Lipid metabolism
   00071 Fatty acid degradation
    PA1R_gp2702
   00072 Synthesis and degradation of ketone bodies
    PA1R_gp2702
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PA1R_gp2702
   00310 Lysine degradation
    PA1R_gp2702
   00380 Tryptophan metabolism
    PA1R_gp2702
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PA1R_gp2702
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PA1R_gp2702
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PA1R_gp2702
Enzymes [BR:paer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PA1R_gp2702
Exosome [BR:paer04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PA1R_gp2702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3017732..3019009)
Genome map
AA seq 425 aa AA seqDB search
MTQLRRVAIVGGNRIPFARSNTVYATASNQEMLTSALEGLVERYNLHGERLGEVVAGAVL
KHSRDFNLTRECVLGSRLAPETPAYDIQQACGTGLEAAILVANKIALGQIDSGIAGGVDT
TSDAPIGVNEGLRKILLEANRGKSNLDKLKSLLKIRPRHVVPAIPRNGEPRTGLSMGESC
ELMAQTWQIPRDEQDRLAFESHHKLAAAYEEGWQNDLMTPFRGLTRDQNLRPDIDLEKIG
TLKPVFERGSRGTLTAANSTPLTDGASVVLLASEEWAKARGLPILAYFKDGEAAAVNFVD
RQEGLLMAPVYAVPRLLARNGLSLQDFDYYEIHEAFAAQVLCTLKAWEDPEYCKTRLGLD
QPLGSIDRSKLNVKGSSLAAGHPFAATGGRIVANLAKLLSLAEQGRGLISICAAGGQGVT
AIIER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacccagctgcgccgggtcgccattgtcggcggcaaccgtattcccttcgcccgctcg
aacaccgtgtacgccacggcgagcaaccaggagatgctcacttccgccctggaaggcctg
gtggagcgctacaacctgcacggagagcgccttggcgaggtggtggccggcgccgtgctg
aagcattcgcgcgacttcaacctgacccgcgaatgcgtgctcggttcgcgcctggccccg
gaaaccccggcctacgatatccagcaggcctgcggtaccggcctggaggcggcgatcctg
gtggccaacaagatcgccctcgggcagatcgacagcggcatcgccggcggcgtcgatacc
acttccgacgcgccgatcggggtcaacgagggcctgcgcaagattctcctcgaggccaac
cgcggcaagagcaacctggacaagctcaagagcctgctgaagatccgcccgcgccacgtg
gtcccggccatcccgcgcaacggcgagccgcgcaccgggctgtcgatgggggagtcctgc
gaactgatggcgcagacctggcagattccccgcgacgagcaggacaggctggccttcgag
agccaccacaagctggccgcggcctatgaggagggctggcagaacgacctgatgacgccg
ttccgcggcctgacccgcgaccagaacctgcgcccggatatcgacctggagaagatcggc
accctcaagccggtgttcgagcgcggttcgcgcggcaccctcacggcggccaactcgacg
ccgctgaccgacggcgcctcggtggtactgctggccagcgaggagtgggcgaaggcgcgc
ggcctgccgatcctggcctatttcaaggacggcgaggcggcggcggtgaacttcgtcgat
cgccaggagggcctgctgatggcgccggtctacgcggtgccgcggctgctggcacgcaac
ggcctgagtctgcaggacttcgactactacgagatccacgaggccttcgccgcccaggtg
ctctgcaccctgaaggcctgggaagaccccgagtactgcaagacccgcctcggcctcgac
cagccgctgggctccatcgaccgcagcaagctcaacgtcaagggcagctcactggccgcc
ggccacccgttcgccgccacgggaggacggatcgtcgccaacctggccaagctgctctcg
ctggcggagcagggacgcgggctgatttccatctgcgccgccggtgggcagggtgtgacc
gcgatcatcgagcggtaa

DBGET integrated database retrieval system