KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp5631Help
Entry
PA1R_gp5631       CDS       T02929                                 

Definition
1,4-alpha-glucan (glycogen) branching enzyme, GH-13-type (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
paer  Pseudomonas aeruginosa PA1R
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paer00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PA1R_gp5631
Enzymes [BR:paer01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PA1R_gp5631
Exosome [BR:paer04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PA1R_gp5631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6243751..6245949
Genome map
AA seq 732 aa AA seqDB search
MSEPMSERERWQLELDKLQRGLQGDPFAFLGPQRDPGGEGGVLRAYLPGAQRVELLDEDG
ATLAELEQSDPGSGLFQRHLEPLPPRYRLRVHWPDGVQESEDPYAFGPLLGELDLYLFAE
GNHRQLASCLGAQLTRHEGVEGVRFAVWAPNAVRVSVVGDFNGWDGRRHPMRRRYPSGVW
ELFVPRLGEGELYKYELQGHDGLLPLKADPLALACETPPGTASKTCAALRHEWRDQDWLA
RRAERQGYAAPLSIYEVHAGSWRHRDGRPPHWSELAEELIPYVRQLGFTHIELMPVMEHP
FGGSWGYQPLGLFAPTARYGTPEDFAAFVDACHQAGIGVILDWVPAHFPTDAHGLGRFDG
TALYEYEHPFEGFHQDWDTYIYNLGRSEVHGFMLASALHWLRTYHVDGLRVDAVASMLYR
DYSRKEGEWLPNRHGGRENLEAIDFLHHLNQVVASETPGALVIAEESTAWPGVSRPVAEG
GLGFSHKWNMGWMHDSLAYIGEDPLHRRYHHHQLTFGLLYAFSEHFILPISHDEVVHGKH
SLLDKMPGDRWQKFANLRLYLSFMWSHPGKKLLFMGCEFGQWREWNHDGELDWYLLRYPE
HQGVQDLVAALNRLYRELPALHARDGEALGFEWLIGDDQANSVYAWLRHAAGEPSLLAVH
NFTPVPRQGYRIGVPQGGDWDVLLNSDAQAFAGSGAGSQGRVSSESCGAHGQAQSLVLDL
PPLGTLLLRPAG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaccgatgtccgaacgcgaacgctggcaactggagctggacaagctgcagcgc
ggcctgcagggcgatccattcgccttcctcggcccgcagcgcgaccccggcggcgaaggc
ggcgtgctgcgcgcctacctgcccggcgcgcagcgcgtcgagctgctcgacgaagacggc
gcgacgctcgccgaactggagcagagcgaccctggcagcggcttgttccagcgccacctg
gagcccctgccgccgcgctaccgcctgcgcgtgcactggccggacggcgtgcaggaaagc
gaagacccctatgccttcgggccgttgctcggcgaactcgacctttacctgttcgccgaa
ggcaaccaccgccaactggcctcctgcctgggcgcgcaactgacccgtcacgaaggcgtg
gagggcgtgcgcttcgcggtctgggcgccgaacgccgtgcgcgtctcggtggtcggcgat
ttcaacggctgggacgggcgccgtcacccgatgcgacgacgctatccatccggcgtctgg
gaactgttcgtcccgcgcctcggcgagggcgaactgtacaagtacgagttgcagggccac
gacggcctcctgccgctgaaggccgaccccctggcgctggcctgcgagacgccgcccgga
accgcttcgaagacctgcgcggcgttgcgccacgagtggcgcgaccaggactggctggcc
cggcgcgcggagcgccagggctatgcggcaccgctgtcgatctatgaagtccacgccggc
tcctggcgccaccgcgacggccggccgccgcactggtcggaactggcggaggagctgatt
ccctacgtgcgccagctcggcttcacccatatcgagctgatgccggtgatggaacatccc
ttcggcggctcctggggctaccagccgctcgggttgttcgcccccaccgcgcgctacggc
acgccggaggacttcgccgcgttcgtcgacgcctgccaccaggccggcatcggcgtgatc
ctcgactgggtgccggcgcattttcccaccgacgcccacggcctgggccgtttcgacggc
acggcgctgtacgagtacgaacatcccttcgaaggcttccaccaggactgggatacctac
atctacaaccttggccgcagcgaggtgcacggcttcatgctggcctcggcgctgcactgg
ctgcgcacctaccacgtcgacggcctgcgggtggatgcggtggcctcgatgctctatcgc
gactattcgcgcaaggaaggcgaatggctgccgaaccgccatggcggccgggagaacctg
gaggccatcgacttcctccatcacctcaaccaggtggtcgccagcgaaacccccggcgcg
ctggtgatcgccgaggaatccaccgcctggcccggcgtcagccgtccggtggcggagggc
ggcctgggcttcagccataagtggaacatgggctggatgcacgacagcctggcgtacatc
ggcgaagacccgctgcaccggcgctatcaccaccaccagttgaccttcggcctgctctac
gccttctccgagcatttcatcctgccgatctcccacgacgaggtggtacatggcaagcac
tcgctactggacaagatgcccggcgaccgctggcagaagttcgccaacctgcgcctgtac
ctgagcttcatgtggtcgcacccgggcaagaagctgctgttcatgggatgcgagttcggc
cagtggcgcgagtggaaccacgacggcgaactggactggtacctgctgcgctatccggag
catcagggcgtacaggacctggtggcggccctcaaccggctgtaccgcgaactccccgca
ctgcatgcgcgggacggcgaggcgctcggcttcgaatggctgatcggcgacgaccaggcg
aacagtgtctacgcctggctgcgccacgcggccggcgagccatcgctgctggcggtacac
aatttcaccccggtgccgcgccagggctatcggatcggcgtaccgcaaggcggcgactgg
gacgtgctgctcaatagcgacgcccaggcgttcgccggttccggcgcaggcagccagggc
cgcgtctccagcgagtcgtgcggcgcccatggccaggcgcagtccctggtgctcgacctg
ccgccgctgggcacgctgctgctgcgtccggccggctga

DBGET integrated database retrieval system