KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_0274Help
Entry
SCV20265_0274     CDS       T02971                                 

Definition
5-aminovalerate aminotransferase/Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC:2.6.1.19 2.6.1.48)
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
paes  Pseudomonas aeruginosa SCV20265
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paes00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SCV20265_0274
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCV20265_0274
   00310 Lysine degradation
    SCV20265_0274
Enzymes [BR:paes01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SCV20265_0274
    2.6.1.48  5-aminovalerate transaminase
     SCV20265_0274
Amino acid related enzymes [BR:paes01007]
 Aminotransferase (transaminase)
  Class III
   SCV20265_0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
300304..301584
Genome map
AA seq 426 aa AA seqDB search
MSKTNESLLKRRQAAVPRGVGQIHPVVAERAENSTVWDVEGREYIDFAGGIAVLNTGHLH
PKVIAAVQEQLGKLSHTCFQVLAYEPYIELAEEIAKRVPGDFPKKTLLVTSGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALAPCELHGVS
EDDSIASIERIFKNDAQPQDIAAIIIEPVQGEGGFYVNSKSFMQRLRALCDQHGILLIAD
EVQTGAGRTGTFFATEQLGIVPDLTTFAKSVGGGFPISGVAGKAEIMDAIAPGGLGGTYA
GSPIACAAALAVLKVFEEEKLLERSQAVGERLKAGLREIQAKHKVIGDVRGLGSMVAIEL
FEGGDTHKPAAELVSKIVVRAREKGLILLSCGTYYNVIRFLMPVTIPDAQLEKGLAILAE
CFDELA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccaacgaatccctgctgaagcgtcgccaggccgcggtaccccgcggcgtg
ggccagatccacccggtcgtcgccgagcgcgccgagaactccaccgtctgggacgtggaa
ggccgcgagtacatcgacttcgccggcggcatcgccgtgctgaacaccggccacctgcat
ccgaaggtgatcgccgcggtccaggagcaactgggcaagctgtcccacacctgcttccag
gtgctggcctacgaaccctacatcgagctggccgaggaaatcgccaagcgcgtgccgggc
gacttcccgaagaagaccctgctggtcacctccggctccgaagccgtggagaacgccgtc
aagatcgcccgcgccgccaccggccgcgctggcgtgatcgccttcaccggcgcgtaccac
ggccgcaccatgatgaccctgggcctgaccggcaaggtggtcccgtactccgccggcatg
ggcctgatgccgggcggcatcttccgcgccctggcgccctgcgagctgcacggcgtgagc
gaggacgactccatcgccagcatcgagcgcatcttcaagaacgatgcccagccccaggac
atcgccgcgatcatcatcgagccggtgcagggcgagggtggcttctacgtcaactccaag
tccttcatgcagcgcctgcgcgccctgtgcgaccagcacggcatcctgctgatcgccgac
gaagtgcagaccggcgccggccgtaccggcaccttcttcgctaccgagcaactgggcatc
gttcctgacctgaccaccttcgccaagtcggtcggcggcggcttcccgatctccggcgtg
gccggcaaggccgagatcatggacgccatcgcgcccggcggcctgggcggcacctatgcc
ggcagcccgatcgcctgcgccgcggcactggccgtgctgaaggtgttcgaggaagagaag
ctgctggaacgttcgcaagccgtcggcgagcgcctcaaggccggcctgcgcgagatccag
gccaagcacaaggtgatcggcgacgttcgtggcctgggttcgatggtggccatcgagctg
ttcgagggcggcgatacccacaagccggccgccgagctggtcagcaagatcgtcgtccgt
gcgcgcgagaagggcctgatcctgctctcctgcggcacctactacaacgtcatccgcttc
ctcatgcccgtcaccatccccgacgcgcaactggagaagggcctggccatcctggccgag
tgcttcgacgaactcgcttaa

DBGET integrated database retrieval system