KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_0439Help
Entry
SCV20265_0439     CDS       T02971                                 

Definition
Amine oxidase [flavin-containing] A (EC:1.4.3.4)
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
paes  Pseudomonas aeruginosa SCV20265
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:paes00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCV20265_0439
   00330 Arginine and proline metabolism
    SCV20265_0439
   00340 Histidine metabolism
    SCV20265_0439
   00350 Tyrosine metabolism
    SCV20265_0439
   00360 Phenylalanine metabolism
    SCV20265_0439
   00380 Tryptophan metabolism
    SCV20265_0439
Enzymes [BR:paes01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     SCV20265_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
468259..469749
Genome map
AA seq 496 aa AA seqDB search
MSLRWLRAAAFLMLGVFSAVALGKDKQPTAIVVGAGLAGLSAAYELQKDGWQVTVLEARP
QVGGRSGLATSEWVGNQKVQPTLNAYLDTFKLKPVPAPDFVRTPSYLIDGLYYSSSDLAL
KQPNVAADLKRFESTLDDLSASISDPLNPASSNTLFALDQMNAARWLDKLNLSPTARLLV
NQRIRSRYDEPSRLSLLYLAQQGRAYRGVDDRDLRAARLPGGSQVLAEAFVKQIKTIKTK
SKVSSIVQAKDGVAVKAGSETYKADYVVLAVPLKALGQIQMTPSLSGTQMSALKGTNYGW
RDQILLKFKRPVWDDKSRLSGEIFSDQGLGMIWVEPALKGGANVLINLSGDNARVLQAFG
DRQMVDQVLIRMNKFYPKMRGAFAGYEIRRYSADPGTGGSYLAYGPGQVTRFWRIWEQPL
SRVAFAGEHTDALYPGTIEGALRSGKRAASQVRDLYAGKTPVIEGAPMVAKAEKVAAPTT
GGEKKNPFAWFTRLFD
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttaaggtggctgcgcgccgcggcgtttctcatgttgggggtgttcagcgcggtg
gcgctgggcaaggataaacagcctacggcgatcgtcgtcggcgcgggcctggcaggcctg
agcgcggcctacgaattgcagaaggacggctggcaggtcacggtgctcgaggcgcggccg
caggtgggcgggcgttccggcctggccaccagcgaatgggtcggcaaccagaaggtccag
cccacgctcaatgcctacctggacaccttcaagctgaagccggtgccggcgccggacttc
gtccgcacccccagctacctgatcgacggcctgtactacagcagcagcgatctcgcgctc
aagcagccgaacgtcgccgccgacctcaagcgcttcgagtcgaccctggacgatctctcg
gcatcgatctccgacccgctcaaccctgcctcgagcaataccctgttcgccctcgaccag
atgaacgccgcgcgctggctggacaagctgaacctgtcgccgaccgcgcgcctgctggtc
aaccagcgtatccgttcgcgctacgacgaaccgtcgcgcctgtcgctgctctacctcgcc
cagcagggccgcgcctaccgtggcgtcgacgaccgcgacctgcgcgcggcgcgcctgccc
ggcggcagccaggtgctggcggaagccttcgtcaagcagatcaagacgatcaagaccaaa
tccaaggtgtcgagcatcgtccaggccaaggacggcgtcgccgtcaaggccggcagcgag
acctacaaggccgactacgtggttctcgccgtgccgctgaaggcgctcggccagatccag
atgaccccgtccctgagcggtacccagatgtccgcgctgaagggcaccaactatggctgg
cgcgaccagatcctgctgaagttcaagcgtccggtgtgggacgacaagtcgcgcctctcc
ggcgagatcttcagcgaccagggcctgggcatgatctgggtcgagccggcgctgaaaggc
ggcgccaacgtcctgatcaacctgtccggcgacaacgcccgcgtgctgcaggctttcggc
gaccggcagatggtcgatcaggtgctgatccgcatgaacaagttctatccgaagatgcgc
ggtgccttcgccggctacgaaattcgtcgctacagcgccgatccgggtaccggtggttcc
tacctggcctacggtccgggccaggtgacgcgtttctggcggatctgggaacagccgctg
tcgcgggtcgccttcgccggcgagcacaccgatgcgctgtaccccggcaccatcgagggc
gcgctgcgtagcggcaagcgcgcggccagccaggtgcgcgacctgtatgccggcaagacg
ccggtgatcgagggcgcgccgatggtggcgaaggccgagaaggtggccgcaccgacgacc
ggcggcgagaagaagaacccgttcgcctggttcacccgcctgttcgattga

DBGET integrated database retrieval system