KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_3228Help
Entry
SCV20265_3228     CDS       T02971                                 

Definition
Trehalose synthase (EC:5.4.99.16)
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
paes  Pseudomonas aeruginosa SCV20265
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:paes00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3448211..3451528)
Genome map
AA seq 1105 aa AA seqDB search
MARREKPVFLNDPQWYKDAVIYQVHVKSFYDANNDGIGDFAGLIEKLDYIADLGVNTLWL
LPFYPSPRRDDGYDIAQYRGVHSDYGSLADARRFIAEAHRRGLRVITELVINHTSDQHPW
FIRARHAKKGSRARDYYVWSDSDEKYQGTRIIFIDTEQSNWTWDPVAQQYYWHRFYSHQP
DLNFDNPQVLNPQVLREVLGVMRYWLDMGVDGLRLDAIPYLIERDGTSSENLPETHQVLK
RIRAELDAHYPDRMLLAEANQWPEDTRPYFGGEDGGEGDECHMAFHFPLMPRMYMAIAQE
DRYPITDILRQTPDIPANCQWAIFLRNHDELTLEMVTDDERDYLWNHYAADRRARLNLGI
RRRLAPLVERDRRRIELLHSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSVD
RNGGFSRADPAKLVLPPILDPLYGYQTINVEAQARDPHSLLNWMRRLLAVRSQQKAFGRG
SLKMLAPSNRRILAYLREYAEGERQDSILCVANLSRAAQAVELDLASHAGKVPVEMIGGM
SFPPIGELTYLLTLPPYGFYWFYLADATQMPSWHVAADERLPELPTLVVKQRLGELLQGA
SRNILEGETLPAYLPKRRWFAGEKGQPRLCYIVPLDEAEPRCALCEVEIDGLRYQLPLGF
LDADQRGDSLPQLLALARLRRGRKVGLLTDAASLPLFARKVLAQLRAEAVIAHGDGEIQF
IPAAGLAEMDDIADEDVLPFSVEQSNSSIRFGERMVLKVLRKILPGLHPEIEVGGYLTRH
GYPGIAPLLGEVRRVGADGEPHTLMILQGYLNNQGDAWNWTLDNLERAVRDEISAASEAL
EGQYDSLAELRGFAANLGARLGEMHSVLAGESDDPAFGSRESDEASVQAWALRIAEQLRE
AGKRLSEPPRPLQGEAAEQARRLLERLPALLERLPLLARQAAGGLLIRVHGDLHLGQVLM
VQGDARFIDFEGEPARSLEERRQRHSPMKDVGGMLRSFDYAAAMVLRNAQSTDSSEQADS
ARRKVAMRYRSEARDAFLAGYRAAAAGLMHAWQGREGEGAALALACLEKAAYELLYEADY
RPDWLEVPLAGLAELTEHLLKGKNR
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atggccagacgcgagaagccggtctttctcaacgacccgcaatggtacaaggacgcggtg
atctaccaggtccacgtgaaatccttctacgacgccaacaacgatggcatcggcgacttc
gccgggctgatcgagaagctcgactacatcgccgacctcggcgtgaacactctctggctg
ctgccgttctacccgtcgccacgccgcgacgacggctacgacatcgcccagtaccgtggc
gtgcacagcgactacggcagcctcgccgacgcccgccggttcatcgccgaggcccatcga
cgcggtctgcgggtgattaccgagctggtgatcaaccacacctccgaccagcatccctgg
ttcatccgcgcccgccacgcgaagaaggggtcgcgcgcccgcgactactacgtctggtcg
gacagcgacgagaaataccagggtacgcggatcatcttcatcgacaccgagcagtccaac
tggacctgggacccggtagcccaacagtactactggcaccgcttctattcccaccagccg
gacctgaacttcgacaacccgcaggtcctgaacccgcaggtcctgcgcgaggtgctcggg
gtgatgcgctactggctggacatgggcgtcgacggcctgcgcctggacgcgattccctac
ctgatcgaacgcgacggcaccagcagcgagaacctgccggagacccaccaggtgctcaag
cgcatccgcgccgagctggacgcgcactatcccgaccgcatgctgctggccgaggccaac
cagtggccggaagacacccggccgtacttcggcggcgaggatggcggcgagggcgacgaa
tgccacatggccttccacttcccgctgatgccgcgcatgtacatggccatcgcccaggag
gatcgctatccgatcaccgacatcctgcgccagaccccggacatcccggccaattgccaa
tgggcgatcttcctgcgcaaccacgacgagctgaccctggagatggtcaccgacgacgag
cgcgactatctctggaaccactatgccgccgaccgccgcgcgcgcctcaacctgggcatc
cgccggcgcctggcgccgctggtggagcgtgaccggcggcgcatcgagctgctgcacagc
ctgctgttgtcgatgccgggcacgccgaccctgtactacggcgacgagatcggcatgggc
gacaacatctacctcggcgaccgcgacggcgtgcggaccccgatgcagtggtcggtggac
cgcaacggcggcttctcccgcgccgacccggcgaagctggtgctgccgccgattctcgac
ccgctgtacggctaccagacgatcaacgtcgaggcgcaggcgcgcgacccgcattcgctg
ctcaactggatgcgccgcctgctcgccgtgcgcagccagcagaaggccttcggccgcggc
agcctgaagatgctcgcgccgagcaaccgacggatcctcgcctacctgcgcgaatacgcc
gagggcgaacggcaggacagcatcctctgcgtggccaacctgtcgcgcgcggcccaggcg
gtggaactggacctcgccagccatgccggcaaggtgccggtggagatgatcggcggcatg
tcgttcccgccgatcggcgagctgacctacctgctgaccctgccgccctacggcttctac
tggttctacctggccgacgcgacgcagatgccgagctggcacgtggccgccgacgagcgc
ctgccggaactgccgaccctggtggtcaagcagcgcctcggcgagctgctgcagggcgca
tcgcggaacatcctggaaggcgagacgctgccggcctacctgccgaagcgccgctggttc
gccggcgagaaaggccagccacggctctgctacatcgttccgctggacgaggcggagccg
cgctgtgcgttgtgcgaagtggagatcgacgggctgcgctaccagttgccgttgggcttc
ctcgacgccgaccagcgcggcgacagcctgcctcagttgctggccctggcgcgcctgcgg
cgcggtcgcaaggtcggcctgctgaccgacgccgccagcctgccgctgttcgcccgcaag
gtcctcgcgcaactccgcgccgaggcggtgatcgcccacggcgacggcgagatccagttc
atcccggcggcgggactggcggaaatggacgacatcgccgacgaagacgtcctgccgttc
tcggtggagcagtccaacagctcgatccgcttcggcgagcgcatggtcctcaaggtgctg
cgcaagatccttccggggctgcacccggaaatcgaggtcggcggctacctgacccgccac
ggctaccccggcatcgccccgttgctcggcgaggtacggcgggtcggcgcggatggcgag
ccgcacacgctgatgatcctgcagggctacctgaacaaccagggcgacgcctggaactgg
accctggacaacctggagcgagccgtgcgcgacgagatatccgcggccagcgaggcgctc
gaagggcaatacgacagcctcgccgaactgcgcggcttcgccgccaacctcggcgcccgg
ctcggcgagatgcacagcgtactggccggcgagtcggacgatccggccttcggcagccgc
gagagcgacgaagccagcgtccaggcctgggcgctgcgcatcgccgaacagttgcgcgaa
gccggcaaacgcctgagcgagccgccacggccgttgcagggcgaggcggcggaacaggcg
cggcgcctgctggaacgcctgccggcgctgctcgaacgcctgccgctgctggcccggcag
gcagccggcgggctgctgatcagggttcacggcgacctgcacctgggccaggtgctgatg
gtccagggcgacgcacgcttcatcgacttcgagggcgagccggcgcgcagcctggaagag
cgccgccagcgccacagtccgatgaaggacgtcggcggcatgctgcgctcgttcgactac
gcggcggcgatggtcctgcgcaacgcgcagagcaccgatagctcggaacaggccgacagc
gcccggcgcaaggtcgccatgcgctatcgcagcgaagcccgcgacgccttcctggccggc
tatcgggccgccgcggcgggtctcatgcacgcctggcagggtcgcgaaggcgagggggcg
gcgctggccctggcctgcctggaaaaggccgcctacgaactgctctacgaagccgactac
cgccccgactggctggaagtgcctctcgccggtctggccgaactcaccgaacacctcctg
aagggcaagaaccgatga

DBGET integrated database retrieval system