KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_5352Help
Entry
SCV20265_5352     CDS       T02971                                 

Definition
Multimodular transpeptidase-transglycosylase (EC:2.4.1.129)
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
paes  Pseudomonas aeruginosa SCV20265
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:paes00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCV20265_5352
Enzymes [BR:paes01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     SCV20265_5352
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     SCV20265_5352
Glycosyltransferases [BR:paes01003]
 Polysaccharide
  Bacterial polysaccharide
   SCV20265_5352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5692252..5694471)
Genome map
AA seq 739 aa AA seqDB search
MLLAGFAIYLDAVVQEKFSGRRWTIPAKVYARPLELFNGLKLSREDFLRELDALGYRREP
SVSGPGTVSVAASAVELNTRGFQFYEGAEPAQRVRVRFNGNYVSGLSQANGKELAVARLE
PLLIGGLYPAHHEDRILVKLDQVPTYLIDTLVAVEDRDFWNHHGVSLKSVARAVWVNTTA
GQLRQGGSTLTQQLVKNFFLSNERSLSRKINEAMMAVLLELHYDKRDILESYLNEVFLGQ
DGQRAIHGFGLASQYFFSQPLAELKLDQVALLVGMVKGPSYFNPRRYPDRALARRNLVLD
VLAEQGVATQQEVDAAKQRPLGVTRQGSMADSSYPAFLDLVKRQLRQDYRDEDLTEEGLR
IFTSFDPILQEKAETSVNETLKRLSGRKGVDQVEAAMVVTNPETGEIQALIGSRDPRFAG
FNRALDAVRPIGSLIKPAVYLTALERPSKYTLTTWVQDEPFAVKGQDGQVWRPQNYDRRS
HGTIFLYQGLANSYNLSTAKLGLDVGVPNVLQTVARLGINRDWPAYPSMLLGAGSLSPME
VATMYQTIASGGFNTPLRGIRSVLTADGQPLKRYPFQVEQRFDSGAVYLVQNAMQRVMRE
GTGRSVYSQLPSSLTLAGKTGTSNDSRDSWFSGFGGDLQAVVWLGRDDNGKTPLTGATGA
LQVWASFMRKAHPQSLEMPMPENVVMAWVDAQTGQGSAADCPNAVQMPYIRGSEPAQGPG
CGSQNPAGEVMDWVRGWLN
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgctcctcgccggcttcgccatctatctcgatgccgtggtgcaggagaaattctccggc
cggcgctggaccatcccggcgaaggtctatgcccgcccgctggagctgttcaacggcctg
aagctgagcagggaagacttcctgcgcgaactcgacgccctcggctaccgtcgcgagccc
agcgtgagcggccctggaaccgtatcggtggcggccagcgcggtcgaactcaatacccgt
ggcttccagttctacgagggcgcggaaccggcccagcgcgtgcgcgtgcgcttcaacggc
aactacgtcagcgggctgagccaggccaacggcaaggaactggcggtggcgcgccttgag
ccgctgctgatcggcggcttgtatccggcgcaccatgaggatcgcatcctggtcaagctc
gaccaggtgccgacctacctgatcgacaccctggtcgcggtcgaggatcgcgacttctgg
aaccaccatggcgtgtcgctgaaatccgtggcccgggcggtgtgggtcaacaccacggcc
ggccagctgcgccagggcggcagcaccctgacccagcagttggtgaagaacttcttcctg
agcaacgaacgcagtctgagccgcaagatcaacgaagcgatgatggcggtgctgctggaa
ctgcactacgacaagcgcgacatcctcgagtcctatctcaacgaggtgttcctcggccag
gatgggcaacgagcgatccatggcttcggcctggccagccagtatttcttcagccagccg
ctggccgagctcaagctcgaccaggtggcgctgctggtcggcatggtcaagggaccgtcc
tacttcaacccgcggcgttacccggatcgtgcgctggcgcggcgcaacctggtgctcgac
gtgctcgccgagcagggcgtggcgacccagcaggaagtcgacgccgccaagcagcgcccg
ctcggcgttacccggcagggcagcatggccgacagctcctatccggccttcctcgacctg
gtcaagcgccagttgcgccaggactaccgcgacgaggacctgaccgaggaagggctgcgc
atcttcaccagcttcgatccgatcctgcaggaaaaggccgagacctccgtcaacgaaacg
ctcaagcgcctcagtgggcgcaagggagtcgaccaggtcgaggcggcgatggtcgtgacc
aatccggaaaccggcgagatccaggccctgatcggcagtcgcgacccgcgcttcgccggc
ttcaaccgggccctggacgcggtgcggccgatcggttcgctgatcaagccggcggtctac
ctgaccgctctcgagcggccgagcaagtacaccctgaccacctgggtgcaggacgagccc
ttcgcggtgaaaggccaggacggccaggtctggcgaccgcagaactacgaccggcgctcg
catggcacgatcttcctgtaccagggcctggcaaactcctacaacctgtccaccgccaag
ctcggcctcgacgtcggtgtgcccaacgtgctgcagaccgtcgcccggctgggtatcaac
cgtgattggccggcctatccgtcgatgctgctgggcgccggttcgctcagtccgatggag
gttgccaccatgtaccagaccatcgccagcggcggcttcaacacgccgttgcgggggatc
cgcagcgtcctcactgccgacggccagccgctcaagcgctatccgttccaggtcgaacag
cgcttcgactcgggcgccgtctacctggtgcagaacgccatgcagcgggtcatgcgcgaa
ggcaccgggcgttcggtgtacagtcaattgccgtcgtcgctgaccctcgccggcaagacc
ggcaccagcaacgactcgcgcgatagctggttctccggtttcggcggcgacctccaggct
gtggtctggctcggtcgcgacgacaacggcaagacgccgcttaccggcgccaccggtgcc
ttgcaggtgtgggccagcttcatgcgcaaggcgcatccgcaatcgctggaaatgccgatg
ccggagaacgtggtgatggcctgggtcgacgcgcagaccgggcagggctcggcggcggat
tgcccgaatgccgtacagatgccctatattcgtggcagcgagcccgcccagggcccaggc
tgcgggagccagaaccccgccggcgaggtgatggactgggtacgtggctggctgaattga

DBGET integrated database retrieval system