KEGG   Pseudomonas aeruginosa PA38182: BN889_02112Help
Entry
BN889_02112       CDS       T03031                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
paeu  Pseudomonas aeruginosa PA38182
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:paeu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BN889_02112 (rbsK)
Enzymes [BR:paeu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BN889_02112 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2200163..2201089
Genome map
AA seq 308 aa AA seqDB search
MQAKVLVVGSLNMDLVVRAPRLPRGGETLAGQSFITVPGGKGANQAVAAARLGAEVAMIG
CLGDDAYGDQLYRALQAEGIDCQGVERVAGESSGVALIVVDDSSQNAIVIVAGGNGHLSP
AVLARHEHMLEQAQVVVCQLESPLETVGHVLRRAHALGKTVILNPAPATRDVPAEWLPLA
DYLVPNETESELLCRLPVDSLESAGRAAERLREMGAGRVIVTLGAQGALLVGEGRVEHFP
VARVKALDTTAAGDTFVGGFAAALARGLDEAAAIRFGQAAAAISVTRLGAQTSIPSREEV
ERALAGEA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgaaagtactggtggtgggcagcctgaacatggacctggtagtgcgcgcgccg
cgcctgccacggggcggcgagaccctcgccgggcagtccttcatcaccgttcccggcggc
aagggagccaaccaggcggtcgccgcggcgcgtctcggcgcggaggtggcgatgatcggc
tgccttggcgacgatgcctacggcgaccagttgtaccgtgcgctacaggccgagggcatc
gactgccagggcgtcgagcgggtggccggggagtccagcggagtggcgctgatcgtggtc
gacgatagcagccagaacgccatcgtcatcgtcgccggcggcaacggccacctgtcgccg
gccgtgctggcgcgccacgaacacatgctggagcaggcgcaggtggtggtctgccagctg
gaaagcccgctggagacggttggccatgtgctgcgccgggcccatgcgctgggcaagacg
gtgatcctcaacccggcgccggccacccgcgacgtgccggcggagtggctgccgctggcg
gactacctggtccccaacgagaccgaaagcgaactgctctgccgcctgccggtggactcc
ctggagagcgccgggcgtgccgccgagcgcctgcgcgaaatgggcgccggcagggtgatc
gtcaccctcggcgcccagggcgccctgctggtgggcgaggggcgggtcgagcatttcccg
gtggcgcgggtcaaggcgctggataccacggcggccggggacaccttcgtcggcggcttc
gccgcggcccttgcgcgcggcctcgacgaggcggcggcgatccgcttcggccaggccgcc
gcggcgatctcggtgacccgccttggcgcgcagacctcgatcccctcgcgcgaggaagtc
gagcgggcgctcgctggcgaggcttga

DBGET integrated database retrieval system