KEGG   Pseudomonas aeruginosa PAO1-VE13: N297_1784Help
Entry
N297_1784         CDS       T03097                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paev  Pseudomonas aeruginosa PAO1-VE13
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:paev00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    N297_1784
   00630 Glyoxylate and dicarboxylate metabolism
    N297_1784
   00640 Propanoate metabolism
    N297_1784
   00650 Butanoate metabolism
    N297_1784
  Lipid metabolism
   00071 Fatty acid degradation
    N297_1784
   00072 Synthesis and degradation of ketone bodies
    N297_1784
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    N297_1784
   00310 Lysine degradation
    N297_1784
   00380 Tryptophan metabolism
    N297_1784
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    N297_1784
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    N297_1784
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    N297_1784
Enzymes [BR:paev01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     N297_1784
Exosome [BR:paev04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N297_1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1878975..1880180
Genome map
AA seq 401 aa AA seqDB search
MTDAFIYDAVRTPRGKGKKDGALHSVKPVNLMAGLLRAVQRRNDLDTAQVDDIVLGCVTP
VGDQGADIAKTAALVADWDEQVAGVQINRFCASGLEAVNLGAMKVRSGFEDLVLVGGVES
MSRVPMGSDGGAWALDPETNLHTSFVPQGIGADLIATLEGFSRADVDAFALRSQQKAAKA
RAEGLFGKSLVPVADQNGIVLLDHDEFIRADSTLEGLAALKPSFEMMGQMGFDATALRKY
SQVERIEHVHTPGNSSGIVDGASAMLIGSEAKGRELGLKARARIVATAVTSTDPTIMLTG
PAPATRKALAKAGLKVEDIDLFEVNEAFASVVMKFMKDMGVAESKVNVNGGAIAMGHPLG
ATGCIILGTLLDELERRNLRYGLATLCVGGGMGIATIIERV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcattcatttacgacgccgtgcgtactccccgcggcaagggcaagaaggat
ggcgcgctgcacagcgtcaagccggtgaacctgatggccgggctgttgcgcgcggtccag
cggcgcaacgacctggataccgcccaggtcgacgatatcgtgctcggctgcgtgacgccg
gtgggcgaccagggcgccgatatcgccaagaccgcggcgctggtggccgactgggacgaa
caggttgccggcgtgcagatcaaccgtttctgcgcctccggcctggaggcggtgaacctg
ggggcgatgaaggtacgctccggcttcgaggacctggtcctggtcggtggcgtcgagtcc
atgtcacgcgtgccgatgggctccgacggcggcgcctgggcactggatccggaaaccaac
ctgcacaccagcttcgtcccgcaagggatcggcgccgacctgatcgccaccctggaaggc
ttcagtcgcgccgatgtcgatgccttcgccctgcgctcccagcagaaggccgccaaggcc
cgcgccgaagggctgttcggcaagtcgctggtgccggtcgccgaccagaatggcatcgtc
ctgctcgaccacgatgagttcattcgcgccgactccaccctggaagggctcgccgcgctc
aaaccgagtttcgagatgatggggcagatgggcttcgacgccaccgcgctgcgcaagtac
agccaggtcgagcgcatcgagcacgtgcatacgccgggcaacagctcggggatcgtcgac
ggcgccagcgccatgctcattggctccgaggccaagggccgcgaactgggcctgaaggcg
cgggcgcggatcgtcgctaccgcggtgacctccaccgaccccaccatcatgcttaccggc
cccgcgccggcgacccgcaaggccctggccaaggccggcctgaaggtggaagacatcgac
ctgttcgaagtcaacgaggcgttcgcttcggtggtgatgaagttcatgaaggacatgggc
gtggcggaaagcaaggtcaacgtcaacggcggcgccatcgccatgggccacccgctcggc
gccaccggctgcatcatcctcggcacgctgctcgacgaactggagcggcgcaacctgcgc
tacggcctggccaccctctgcgtaggcggcggcatgggcatcgccaccatcatcgagcgc
gtgtga

DBGET integrated database retrieval system