KEGG   Pseudomonas aeruginosa PAO1-VE13: N297_2222Help
Entry
N297_2222         CDS       T03097                                 

Gene name
treS
Definition
trehalose synthase (EC:5.4.99.16)
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
paev  Pseudomonas aeruginosa PAO1-VE13
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paev00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    N297_2222 (treS)
Enzymes [BR:paev01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     N297_2222 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     N297_2222 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2368106..2371408
Genome map
AA seq 1100 aa AA seqDB search
MARREKPVFLNDPQWYKDAVIYQVHVKSFYDANNDGIGDFAGLIEKLDYIADLGVNTLWL
LPFYPSPRRDDGYDIAQYRGVHSDYGSLADARRFIAEAHRRGLRVITELVINHTSDQHPW
FIRARHAKKGSRARDYYVWSDSDEKYQGTRIIFIDTEQSNWTWDPVAQQYYWHRFYSHQP
DLNFDNPQVLREVLGVMRYWLDMGVDGLRLDAIPYLIERDGTSSENLPETHQVLKRIRAE
LDAHYPDRMLLAEANQWPEDTRPYFGGEDGGEGDECHMAFHFPLMPRMYMAIAQEDRYPI
TDILRQTPDIPANCQWAIFLRNHDELTLEMVTDDERDYLWNHYAADRRARLNLGIRRRLA
PLVERDRRRIELLHSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSVDRNGGF
SRADPAKLVLPPILDPLYGYQTINVEAQARDPHSLLNWMRRLLAVRSQQKAFGRGSLKML
APSNRRILAYLREYAEGERQDSILCVANLSRAAQAVELDLASHAGKVPVEMIGGMSFPPI
GELTYLLTLPPYGFYWFYLADATQMPSWHVAADERLPELPTLVVKQRLGELLQGASRNIL
EGETLPAYLPKRRWFAGEKGQPRLCYIVPLDEAEPRCALCEVEIDGLRYQLPLGFLDADQ
RGDSLPQLLALARLRRGRKVGLLTDAASLPLFARKVLAQLRAEAVIAHGDGEIQFIPAAG
LAEMDDIADEDVLPFSVEQSNSSIRFGERMVLKVLRKILPGLHPEIEVGGYLTRHGYPGI
APLLGEVRRVGADGEPHTLMILQGYLNNQGDAWNWTLDNLERAVRDEISAASEALEGQYD
SLAELRGFAANLGARLGEMHSVLAGESDDPAFGSRESDEASVQAWALRIAEQLREAGKRL
SEPPRPLQGEAAEQARRLLERLPALLERLPLLARQAAGGLLIRVHGDLHLGQVLMVQGDA
RFIDFEGEPARSLEERRQRHSPMKDVGGMLRSFDYAAAMVLRNAQSTDSSEQADSARRKV
AMRYRSEARDAFLAGYRAAAAGLMHAWHGREGEGAALALACLEKAAYELLYEADYRPDWL
EVPLAGLAELTEHLLKGKNR
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atggccagacgcgagaaaccggtctttctcaacgacccgcaatggtacaaggacgcggtg
atctaccaggtccacgtgaaatccttctacgacgccaacaacgatggcatcggcgacttc
gccgggctgatcgagaagctcgactacatcgccgacctcggcgtgaacactctctggctg
ctgccgttctacccgtcgccacgccgcgacgacggctacgacatcgcccagtaccgtggc
gtgcacagcgactacggcagcctcgccgacgcccgccggttcatcgccgaggcccatcga
cgcggtctgcgggtgattaccgagctggtgatcaaccatacctccgaccagcatccctgg
ttcatccgtgcccgccacgcgaagaagggatcgcgcgcccgcgactactacgtctggtcg
gacagcgacgagaaataccagggtacgcggatcatcttcatcgacaccgagcagtccaac
tggacctgggacccggtagcccaacagtactactggcaccgcttctattcccaccagccg
gacctgaacttcgacaacccgcaggtcctgcgcgaggtgctcggggtgatgcgctactgg
ctggacatgggcgtcgacggcctgcgcctggacgcgattccctacctgatcgaacgcgac
ggcaccagcagcgagaacctgccggagacccaccaggtgctcaagcgcatccgcgccgag
ctggacgcgcactatcccgaccgcatgctgctggccgaggccaatcagtggccggaagac
acccggccgtacttcggcggcgaggatggcggcgagggcgacgaatgccacatggccttc
cacttcccgctgatgccgcgcatgtacatggccatcgcccaggaggatcgctatccgatc
accgacatcctgcgccagaccccggacatcccggccaattgccaatgggcgatcttcctg
cgcaaccacgacgagctgaccctggagatggtcaccgacgacgagcgcgactatctctgg
aaccactatgccgccgaccgccgcgcgcgcctcaacctgggcatccgccggcgcctggcg
ccgctggtggagcgtgaccggcggcgcatcgagctgctgcacagcctgctgttgtcgatg
ccgggcacgccgaccctgtactacggcgacgagatcggcatgggcgacaacatctacctc
ggcgaccgcgacggcgtgcggaccccgatgcagtggtcggtggaccgcaacggcggcttc
tcccgcgccgacccggcgaagctggtgctgccgccgattctcgacccgctgtacggctac
cagacgatcaacgtcgaggcgcaggcgcgcgacccgcattcgctgctcaactggatgcgc
cgcctgctcgccgtgcgcagccagcagaaggccttcggccgcggcagcctgaagatgctc
gcgccgagcaaccgacggatcctcgcctacctgcgcgaatacgccgagggcgaacggcag
gacagcatcctctgcgtggccaacctgtcgcgcgcggcccaggcggtggaactggacctc
gccagccatgccggcaaggtgccggtggagatgatcggcggcatgtcgttcccgccgatc
ggcgagctgacctacctgctgaccctgccgccctacggcttctactggttctacctggcc
gacgcgacgcagatgccgagctggcacgtggccgccgacgagcgcctgccggaactgccg
accctggtggtcaagcagcgcctcggcgagctgctgcagggcgcatcgcggaacatcctg
gaaggcgagacgctgccggcctacctgccgaagcgccgctggttcgccggcgagaaaggc
cagccacggctctgctacatcgttccgctggacgaggcggagccgcgctgtgcattgtgc
gaagtggagatcgacgggctgcgctaccagttgccgctgggcttcctcgacgccgaccag
cgcggcgacagcctgcctcagttgctggccctggcgcgcctgcggcgcggtcgcaaggtc
ggcctgctgaccgacgccgccagcctgccgctgttcgcccgcaaggtcctcgcgcaactc
cgcgccgaggcggtgatcgcccacggcgacggcgagatccagttcatcccggcggcggga
ctggcggaaatggacgacatcgccgacgaagacgtcctgccgttctcggtggagcagtcc
aacagctcgatccgcttcggcgagcgcatggtcctcaaggtgctgcgcaagatccttccg
gggctgcacccggaaatcgaggtcggcggctacctgacccgccacggctaccccggcatc
gccccgttgctcggcgaggtacggcgggtcggcgcggatggcgagccgcacacgctgatg
atcctgcagggctacctgaacaaccagggcgacgcctggaactggaccctggacaacctg
gagcgagccgtgcgcgacgagatatccgcggccagcgaggcgctcgaagggcaatacgac
agcctcgccgaactgcgcggcttcgccgccaacctcggcgcccggctcggcgagatgcac
agcgtactggccggcgagtcggacgatccggccttcggcagccgcgagagcgacgaagcc
agcgtccaggcctgggcgctgcgcatcgccgaacagttgcgcgaagccggcaaacgcctg
agcgagccgccacggccgttgcagggcgaggcggcggaacaggcgcggcgcctgctggaa
cgcctgccggcgctgctcgaacgcctgccgctgctggcccggcaggcagccggcgggctg
ctgatcagggttcacggcgacctgcacctgggccaggtgctgatggtccagggcgacgca
cgcttcatcgacttcgagggcgagccggcgcgcagcctggaagagcgccgccagcgtcac
agtccgatgaaggacgtcggcggcatgctgcgctcgttcgactacgcggcggcgatggtc
ctgcgcaacgcgcagagcaccgatagctcggaacaggccgacagcgcccggcgcaaggtc
gccatgcgctatcgcagcgaagcccgcgatgccttcctggccggctatcgggccgccgcg
gcgggtctcatgcacgcctggcacggtcgcgaaggcgaaggggcggcgctggccctggcc
tgcctggaaaaggccgcctacgaactgctctacgaagccgactaccgccccgactggctg
gaagtgcctctcgccggtctggccgaactcaccgaacacctcctgaagggcaagaaccga
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system