KEGG   Pseudomonas aeruginosa PAO1-VE13: N297_4039Help
Entry
N297_4039         CDS       T03097                                 

Definition
phoD-like phosphatase family protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
paev  Pseudomonas aeruginosa PAO1-VE13
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:paev00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    N297_4039
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    N297_4039
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    N297_4039
Enzymes [BR:paev01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     N297_4039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4379682..4381244)
Genome map
AA seq 520 aa AA seqDB search
MSGMDLKRRRVVQGLGAGLLLPALGAPAVIASPRARPKLTDGVQSGDVQGDRALVWSRTD
RPARMIVEWDTRSVFSEPRRLVSPVTDERLDYTARIDLRGLPADQSIFYRVRFEDARDGS
LSKPWFGHLRSAPSEARNIRFVWSGDTCGQGFGINPDIGGMRIYEAMRRRQPDFFLHSGD
TIYADGPIPERIETESGRIWRNRVTEAKSKVAETLDEFRGNYRYNLLDDNLRRFNAEVPQ
IWQWDDHETTNNWSSSKQLDERYQVKDIDVLAARARQAFLEYAPLRFQRQGRDGRIYRKV
AYGPLLDVFVLDMRSYRGGNSANLQARRSAATDFLGREQLQWLKRELRGSRAQWKVIAAD
MPIGLCVPDGKDAQGRDRWEAIANGNDGAALGRELEIADLLRFVQRAGVRNTVWLTADVH
YCAAHHYSPERAAFKDFAPFWEFVAGPLNAGSFGPNALDGTFGPQVMFQKAPLVQNSSPF
AGYQFFGEVEIDAQSRALTVTLRDLDGEPVFSQELQPDGA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggatggacctcaagcgccgccgcgtcgtgcaaggcctgggcgctggactgctg
ttgccggcgctgggcgcgccggcggtgatcgcctcgcccagggcgcggccgaagctgacc
gatggcgtgcaatccggcgatgtgcagggcgaccgcgcgctggtctggagccgcaccgac
cgcccggcgcggatgatcgtcgaatgggacacccgtagcgtcttcagcgagccgcgtcgg
ctggtctcgccggtcaccgacgagcgcctcgactacaccgcgcgcatcgacctgcgtggc
ctgccagccgaccagtcgatcttctaccgggtgcgcttcgaggatgcccgcgacggcagc
ctgagcaagccctggttcggccacctgcgcagtgcgccgagcgaggcgcgcaatatccgt
ttcgtctggagcggcgacacctgcgggcaaggtttcgggatcaatccggatatcggcggc
atgcgtatctacgaagccatgcgccggcgccagccggatttcttcctgcacagcggcgac
accatctatgccgatgggccgatccccgaacgcatcgagaccgagagcgggcgcatctgg
cgcaaccgggtgaccgaggccaagagcaaggtcgccgagaccctcgacgagttccgcggc
aactaccgctacaacctgctcgacgacaacctgcgccgcttcaacgccgaggtgccgcag
atctggcaatgggacgaccacgagaccaccaacaactggtcctccagcaagcagctcgac
gagcgctaccaggtgaaggacatcgacgtgctggcggcccgtgcacgccaggcgttcctc
gaatacgcgccgctgcgcttccagcgccaggggcgcgacgggcggatctaccgcaaggtc
gcctacggccctttgctcgacgtgttcgtcctcgacatgcgcagctaccgcggcggcaac
agcgccaacctgcaggcgcggcgcagcgccgccaccgatttcctcggccgtgagcagttg
caatggctcaagcgcgagttgcgcggttcgcgtgcgcagtggaaggtgatcgccgccgac
atgccgatcggcctctgcgtgcccgatggcaaggacgcccagggccgcgaccgctgggag
gccatcgccaacggcaatgacggcgccgccctcggccgcgagctggagatcgccgacctg
ctgcgcttcgtccagcgcgccggggtgcgcaacaccgtctggctgaccgccgacgtgcat
tactgcgcagcccaccactacagcccggagcgcgccgcgttcaaggacttcgcgccgttc
tgggagttcgtcgccgggcctctcaatgccggtagtttcggacccaacgcgctggatggc
acgttcggcccgcaggtgatgttccagaaggccccgctggtccagaacagttcccccttc
gccggctaccagttcttcggcgaggtggagatcgatgcgcaaagccgcgcgctcaccgtc
accctgcgcgacctcgacggcgagccggtgttttcccaggaactgcagcccgacggcgcc
tga

DBGET integrated database retrieval system