KEGG   Pseudomonas aeruginosa M18: PAM18_0037Help
Entry
PAM18_0037        CDS       T01973                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00260  Glycine, serine and threonine metabolism
paf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
paf01130  Biosynthesis of antibiotics
paf01230  Biosynthesis of amino acids
Module
paf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAM18_0037 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAM18_0037 (trpB)
Enzymes [BR:paf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PAM18_0037 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEO72528
Position
complement(37879..39087)
Genome map
AA seq 402 aa AA seqDB search
MTSYRNGPDAKGLFGRFGGQYVAETLMPLILDLAREYEKAKDDPAFQEELAYFQRDYVGR
PSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAETGAGM
HGVATATVAARFGLQCVIYMGTTDIDRQQANVFRMKLLGAEVIPVTAGTGTLKDAMNEAL
RDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQLAEKEGRLPDSLVACIGGG
SNAMGLFHPFLDDAGVQIVGVEAAGHGIDTGKHAASLNGGVPGVLHGNRTFLLQDADGQI
IDAHSISAGLDYPGIGPEHAWLHDTGRVEYTSITDDEALEAFHTCCRLEGIIPALESSHA
LAEVFKRAPSLPKEHIMVVNLSGRGDKDMQTVMHHMQQESKA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctatcgcaacggccccgacgccaagggcctgttcggccgcttcggcggccag
tacgtcgccgagaccctgatgccgctgatcctcgacctcgcccgcgagtacgagaaggcc
aaggacgacccggcgttccaggaggaactggcctacttccagcgcgactacgtcggccgg
ccgagcccgctgtacttcgccgagcgcctgaccgagcactgcggcggggcgaagatctac
ctcaagcgcgaggagctgaaccataccggcgcgcacaagatcaacaactgcatcggccag
atcctcctggcccggcgcatgggcaagaaacgcatcatcgccgagaccggcgccggcatg
cacggcgtggccaccgccaccgtcgccgcgcgcttcggcctgcagtgcgtgatctacatg
ggcaccaccgacatcgaccggcagcaggccaacgtcttccgcatgaagctgctgggcgcc
gaggtgatcccggtgaccgccggcaccggtaccctgaaggacgccatgaacgaggcgctg
cgcgattgggtgaccaacgtcgacagtaccttctacctgatcggcacggtcgccggcccg
catccgtacccggcgatggtccgtgacttccaggcggtgatcggcaaggaaacccgcgag
caactggccgagaaggaagggcgcctgcccgattcgctggtcgcctgcatcggcggcggc
tccaacgccatgggcctgttccacccgttcctcgacgacgccggggtgcagatcgtcggc
gtggaagccgccggccacggcatcgacaccggcaagcacgcggccagcctgaacggcggg
gttcccggcgtgctgcacggcaaccgcaccttcctgctgcaggacgcggatggccagatc
atcgacgcacactccatctccgccggcctcgactatcccggcatcggcccggaacacgcc
tggctgcacgacaccggccgcgtcgagtacacctcgatcaccgacgacgaagccctggag
gccttccacacctgctgccgcctcgaaggcatcatcccggcgctggaaagctcccatgcc
ctggccgaggtcttcaagcgtgcgcccagcctgcccaaggagcacatcatggtggtgaac
ctgtccggtcgcggcgacaaggacatgcagaccgtcatgcaccacatgcaacaggagtcg
aaagcatga

DBGET integrated database retrieval system