KEGG   Pseudomonas aeruginosa M18: PAM18_1243Help
Entry
PAM18_1243        CDS       T01973                                 

Gene name
wspF
Definition
(GenBank) chemotaxis-specific methylesterase
  KO
K13491  two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf02020  Two-component system
paf02025  Biofilm formation - Pseudomonas aeruginosa
Module
paf_M00509  WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:paf00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PAM18_1243 (wspF)
 Cellular Processes
  Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PAM18_1243 (wspF)
Enzymes [BR:paf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PAM18_1243 (wspF)
Two-component system [BR:paf02022]
 CheA family
  WspE-WspRF [MD:M00509]
   PAM18_1243 (wspF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: AEO73730
Position
1361981..1362988
Genome map
AA seq 335 aa AA seqDB search
MRIGIVNDMPLAVEALRRALAFEPQHQIVWVASNGAEAVTQCAANTPDVVLMDLLMPVMD
GVEATRRIMAESPCAIVIVTVDIEQNVHRVFEAMGYGALDAVNTPALGIGNPQTAAAPLL
RKIQNVGWLIGQRDNRGKVQVVPPKAGGARQRLVAIGASAGGPASLAVLLKQLPASFNAA
VVLVQHVDEVFAAGMAEWLASESKLPVRLARDGEPPIPGQILLAGTNNHIRLLRNGSLVY
TAEPRSFVYRPSIDVFFESVANYWRGDAVGVLLTGMGRDGAQGLKQMRERGFLTIAQDQA
SCAVYGMPKAAAAIDAAVQILSLEKIAPRLAEVFD
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
ttgaggatcggaatcgtcaatgacatgccgttggccgtcgaggcgctgcgccgcgcgctg
gccttcgagccgcagcaccagatcgtctgggtcgccagcaacggtgccgaggcggtgacc
cagtgcgccgccaatacgcccgacgtggtgctgatggacctgctcatgccggtgatggac
ggcgtcgaggcaactcgtcggatcatggcggaaagtccttgcgcgatcgtgattgttacc
gtcgatatcgagcagaatgtgcaccgggttttcgaagcgatgggatatggggcgctcgat
gcggtgaacacgccggcgctgggcatcggcaacccgcaaacggcggcggcgccgttgttg
cgcaagattcagaacgtcggctggctgatcggccagcgcgataaccgtggcaaggtccag
gtggtgccgccgaaggccggcggggcgcgccagcgtctggtggcgatcggcgcctcggct
ggcggtccggcgtcgctcgcggtgttgctcaagcaactgccggccagtttcaatgccgcg
gtggtactggtgcagcatgtcgacgaggtcttcgccgccggcatggccgaatggctggcc
agcgaatcgaagctgccggtgcgcctggcgcgcgatggcgagccgccgataccggggcag
atcctgctggcggggaccaacaatcacatccgcctgctgcgcaacggttcgctggtgtac
accgccgaaccgcgttctttcgtctaccggccgtccatcgacgtgtttttcgagagcgtg
gcgaattattggcgtggcgatgccgtgggcgtgctgctgaccggcatgggccgcgacggc
gcccagggcctcaagcagatgcgcgagcgcggtttcctcaccatcgcccaggaccaggcc
agttgcgcagtctacgggatgccgaaggccgcggcggcgatcgatgcagcggtgcagatc
ctttccctggaaaagatcgccccgcgcctggcggaggtattcgattag

DBGET integrated database retrieval system