KEGG   Pseudomonas aeruginosa M18: PAM18_1406Help
Entry
PAM18_1406        CDS       T01973                                 

Definition
putative carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PAM18_1406
Enzymes [BR:paf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PAM18_1406
Exosome [BR:paf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PAM18_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1538603..1540087
Genome map
AA seq 494 aa AA seqDB search
MSHYLLAIDQGTTSSRAIVFSAQGLPVASCQQEFKQYFPKDGWVEHDGEEIWLTTLQVCR
DALARKGLRAADIAAIGITNQRETTLVWDAASGDLIHPAIVWQDRRTADYCAELKAAGHE
ANVSARTGLLIDPYFSATKLRWILDNVPGARQRAERGELRFGTVDCFLLWRLTGGRSHRT
DATNASRTLLFNIHSQDWDEELLALFEIPRSLLPEVLDCAAEFGVSEPSLLGAAIPVLGM
AGDQQAALIGQACFQPGMVKSTYGTGCFMIQNTGEQPVTSKNRLLTTVGYRLDGKVSYAV
EGSIFVAGAAVQWLRDGIKLIDHAHESEALAIQAGDSNGVYLVPAFTGLGAPYWDPKARG
AIFGLTRDTGIKEIVTAGLQSVCYQTRDLLEAMRQDGTPPSALRVDGGMVVNNWVMQFLT
DILGVTVERPEVTETTALGVAYMAGLKAGFYRDLDDIASHWHLQRRFAAHMAEERRGELY
AGWQNAVRRVRSEA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcccactatctcctcgccatcgaccagggcaccaccagctcccgcgccatcgtgttc
agtgcccagggcttgccggtggcgagctgccagcaggaattcaagcagtacttcccgaag
gacggctgggtggagcacgacggcgaggaaatctggctgaccaccctccaggtctgtcgc
gacgcgctcgcccgcaagggcttgcgcgcggccgacatcgccgccatcggcatcaccaac
cagcgcgagaccacgctggtctgggatgccgccagcggcgacctgatccacccggccatc
gtctggcaggatcgtcgtaccgccgactactgtgccgaactcaaggccgccggccacgag
gcgaacgtcagcgcgcgtaccgggctgctgatcgatccgtatttctccgccaccaagctg
cgctggatcctcgacaacgtgcccggcgcccgccagcgcgccgaacgcggcgagctgcgc
ttcggcaccgtcgactgcttcctgctctggcgcctgaccggcggccgctcccatcgcacc
gacgcgaccaacgcttcgcgcaccctgctgttcaacatccacagccaggactgggacgag
gaattgctggcgctgttcgagatcccgcgcagcctgctgccggaggtactcgactgcgcg
gcggagttcggcgtcagcgagccgtcgctgcttggcgcggcgatcccggtgctgggcatg
gccggcgaccagcaggccgcgctgatcggccaggcctgcttccagccgggcatggtgaag
agcacctacggcaccggctgcttcatgatccagaacaccggcgagcagccggtgacctcg
aagaaccgcctgctcaccacggtcggctaccgcctggacggcaaggtcagctacgcggtg
gagggcagcatcttcgtcgccggcgccgcggtgcaatggctgcgcgacggcatcaagctg
atcgaccacgcccacgagagcgaagccctggcgatccaggccggcgactccaacggcgtc
tacctggtgccggcctttaccggcctcggcgcgccctactgggacccgaaggcgcgcggc
gcgatcttcggcctgacccgcgacaccggaatcaaggagatcgtcaccgccggtctgcaa
tcggtctgctaccagacccgcgacctgctcgaagcgatgcgccaggacggcacgccgccc
agcgcgctgcgggtggacggcgggatggtggtgaataactgggtgatgcaattcctcacc
gacatccttggcgtcaccgtggagcgcccggaagtcaccgagaccaccgccctcggcgtg
gcctacatggccgggctgaaggccggcttctatcgcgacctggacgacatcgccagccac
tggcacctgcagcgccgcttcgccgcgcacatggccgaggagcgccgcggcgaactctac
gccggctggcagaacgcggtgcgacgggtgcgcagcgaggcctga

DBGET integrated database retrieval system