KEGG   Pseudomonas aeruginosa M18: PAM18_1528Help
Entry
PAM18_1528        CDS       T01973                                 

Gene name
folE1
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:paf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1682007..1682567)
Genome map
AA seq 186 aa AA seqDB search
MNPALSQHYREILVGLGEDPQREGLLDTPKRAAKAMQYLCHGYGQTLEEIVNGALFASDN
DEMVIVRDIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKVARIVDMFARRLQIQENLT
RQIAEAVRQVTSAAGVAVVIEAQHMCMMMRGVEKQNSQMFTSVMLGAFRDSNTTRQEFLQ
LIGRSK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaacccagcactttcccagcattaccgggagatcctcgtcggtctcggcgaagacccg
cagcgcgaaggcctgctcgacaccccgaagcgcgcggccaaggccatgcagtacctctgc
cacggctatggccagaccctggaggaaatcgtcaacggcgcgctgttcgcctcggacaac
gatgaaatggtcatcgtccgcgacatcgagctgtactccctgtgcgaacaccacctcctg
cccttcatcggcaaggctcatgtggcgtacattcccaccggcaaggtgctcggcctgtcg
aaggtggcgcggatcgtcgacatgttcgcccgccgcctgcagatccaggagaacctcacc
cggcagatcgccgaggcggtccgccaggtgaccagcgccgctggcgtggcggtagtgatc
gaggcccagcacatgtgcatgatgatgcgcggggtggagaagcagaactcgcagatgttc
acctcggtgatgctcggcgcgttccgcgactcgaacaccacccgccaggaatttctgcaa
ttgatcggaaggagcaagtga

DBGET integrated database retrieval system