KEGG   Pseudomonas aeruginosa M18: PAM18_1539Help
Entry
PAM18_1539        CDS       T01973                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00071  Fatty acid degradation
paf00280  Valine, leucine and isoleucine degradation
paf00281  Geraniol degradation
paf00310  Lysine degradation
paf00360  Phenylalanine metabolism
paf00362  Benzoate degradation
paf00380  Tryptophan metabolism
paf00410  beta-Alanine metabolism
paf00627  Aminobenzoate degradation
paf00640  Propanoate metabolism
paf00650  Butanoate metabolism
paf00903  Limonene and pinene degradation
paf00930  Caprolactam degradation
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
paf01120  Microbial metabolism in diverse environments
paf01130  Biosynthesis of antibiotics
paf01212  Fatty acid metabolism
Module
paf_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PAM18_1539
   00650 Butanoate metabolism
    PAM18_1539
  Lipid metabolism
   00071 Fatty acid degradation
    PAM18_1539
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PAM18_1539
   00310 Lysine degradation
    PAM18_1539
   00360 Phenylalanine metabolism
    PAM18_1539
   00380 Tryptophan metabolism
    PAM18_1539
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PAM18_1539
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PAM18_1539
   00281 Geraniol degradation
    PAM18_1539
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PAM18_1539
   00627 Aminobenzoate degradation
    PAM18_1539
   00930 Caprolactam degradation
    PAM18_1539
Enzymes [BR:paf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PAM18_1539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AEO74026
Position
1690230..1691000
Genome map
AA seq 256 aa AA seqDB search
MSVIVERNGPVTTLVIARPERRNAVDRPTAQALADALREFEADDTARVAVLTGSGGNFCA
GADLAAVAEDGERRNRLEAEGDGPMGPSRMQLGKPLIAAIEGYAVAGGLELALLADLRVM
AEDAICGVFCRRFGVPLIDGGSVRLPRIVGQGRALDLILTGRPVKADEALQIGLANRVVP
SGSARAEAEELAAELAAFPQTCMLADRASVYAQWELSFDVALANEFQGGLAVIESGETLE
GAQRFKDGEGRHGRFE
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcatcgtcgaacgcaacggcccggtcaccaccctggtcatcgctcgcccggag
cggcgcaatgcggtggaccggccgaccgcccaggccctggccgacgccctgcgcgagttc
gaagcggacgatacggcgcgggtcgcggtactcaccggcagcggcggcaatttctgcgcc
ggcgccgacctggcggcggtggccgaggatggcgagcggcgcaatcgcctggaggcggag
ggcgacggaccgatggggccgagccgcatgcagctcggcaagccgctgatcgccgccatc
gaaggttatgcggtggccggcgggctggagctggcgctgctcgccgacctgcgggtgatg
gccgaggacgccatctgcggagtgttctgccggcgtttcggggtgccgctgatcgatggc
ggcagcgtgcgcctgccacggatcgtcgggcagggccgggcgctcgacctgatcctcacc
gggcgtccggtgaaggccgacgaagcgttgcagatcggcctggccaaccgggtggtgccg
agcggttcggcgcgagccgaggccgaggagctggcggcggaactcgccgccttcccgcag
acctgcatgctcgccgatcgcgccagcgtatacgcgcagtgggaactgtccttcgacgtg
gccctggccaacgaattccagggcgggctggcggtgatcgagagcggcgagaccctggag
ggcgcgcagcgcttcaaggacggcgaggggcgccacgggcgcttcgagtga

DBGET integrated database retrieval system