KEGG   Pseudomonas aeruginosa M18: PAM18_1575Help
Entry
PAM18_1575        CDS       T01973                                 

Gene name
nosZ
Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:paf00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1727647..1729557)
Genome map
AA seq 636 aa AA seqDB search
MSDDTKSPHEETHGLNRRGFLGASALTGAAALVGASALGSAVVGREARAAGKGERSKAEV
APGELDEYYGFWSGGHSGEVRVLGVPSMRELMRIPVFNVDSATGWGLTNESKRVLGDSAR
FLNGDCHHPHISMTDGKYDGKYLFINDKANSRVARIRLDVMKCDRIVTIPNVQAIHGLRL
QKVPHTRYVFCNAEFIIPHPNDGSTFDLSGDNAFTLYNAIDAETMEVAWQVIVDGNLDNT
DMDYSGRFAASTCYNSEKAVDLGGMMRNERDWVVVFDIPRIEAEIKAKRFVTLGDSKVPV
VDGRRKDGKDSPVTRYIPVPKNPHGLNTSPDGKYFIANGKLSPTCTMIAIERLGDLFAGK
LADPRDVVVGEPELGLGPLHTTFDGRGNAYTTLFIDSQLVKWNLADAVRAYKGEKVDYIR
QKLDVQYQPGHNHATLCETSEADGKWIVVLSKFSKDRFLPTGPLHPENDQLIDISGEEMK
LVHDGPTFAEPHDCILARRDQIKTRKIWDRKDPFFAETVKRAEKDGIDLMKDNKVIREGN
KVRVYMVSMAPSFGLTEFKVKQGDEVTVTITNLDEIEDVTHGFVMVNHGVCMEISPQQTS
SITFVADKPGVHWYYCSWFCHALHMEMCGRMLVEKA
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacacgaaaagcccccacgaagaaacccacggcctgaaccgccgcggcttc
ctcggcgcctcggcgctgaccggagccgccgccctggttggcgccagcgccctgggcagc
gcggtggtcggccgcgaggcccgggccgcgggcaagggcgagcgcagcaaggccgaggtc
gcccccggcgaactggatgagtactacgggttctggagcggcggacattccggcgaagta
cgcgtgctcggtgtgccgtcgatgcgcgagctgatgcgcataccggtgttcaacgtcgac
tcggccaccggctggggcctgaccaacgagagcaagcgggtcctcggcgacagcgcgcgc
ttcctcaacggcgactgccaccatccgcacatctcgatgaccgacggcaagtacgacggc
aagtacctgttcatcaacgacaaggccaacagccgggtcgcgcgcatccgcctggacgtc
atgaaatgcgaccgcatcgtcaccattcccaacgtccaggcgatccacggcctgcgcctg
caaaaggtgccgcatacccgctacgtgttctgcaacgccgagttcatcatcccccatccc
aacgacggctcgaccttcgacctgtccggcgacaacgccttcaccctgtacaacgccatc
gacgccgagaccatggaagtggcctggcaggtgatcgtcgacggcaacctcgacaacacc
gacatggactacagcggcaggttcgccgcctccacctgctacaactcggaaaaggccgtc
gacctcggcggcatgatgcgcaacgagcgcgactgggtggtggtgttcgacatcccgcgc
atcgaggccgagatcaaggcgaagcgcttcgtcaccctcggcgactcgaaggtgccggtg
gtcgacggccggcgcaaggacggcaaggacagcccggtgacccgctacatcccggtaccg
aagaacccccacgggctgaacacctcgccggacggcaagtacttcatcgccaacggcaag
ctctcgccgacctgcaccatgatcgccatcgagcgcctcggcgacctgttcgccggcaag
ctggccgacccgcgcgacgtggtggtgggcgagccggaactgggcctcggcccgctgcac
accactttcgatggccgaggcaacgcctataccacgctgttcatcgacagccagttggtg
aagtggaacctggccgacgcggtgcgcgcctacaagggcgagaaggtcgactacatccgc
cagaaactcgacgtgcagtaccagccggggcacaaccacgccaccctgtgcgagaccagc
gaagccgacggcaagtggatcgtggtgctcagcaagttctccaaggaccgcttcctgccc
accggtccgctgcacccggagaacgaccagttgatcgacatttccggcgaggaaatgaag
ctggtccacgacggcccgaccttcgccgaaccgcacgattgcatcctcgcccgccgcgac
cagatcaagacccgcaagatctgggaccgcaaggacccgttcttcgccgagacggtcaag
cgcgcggaaaaggacggcatcgacctgatgaaggacaacaaggtcatccgcgagggcaac
aaggtccgcgtctacatggtctcgatggcgccctccttcggcctcaccgagttcaaggtg
aagcagggcgacgaagtcaccgtgaccatcaccaacctcgacgagatcgaggacgtgacc
cacggcttcgtcatggtcaaccacggcgtctgcatggagatcagcccgcaacagacctcg
tcgatcaccttcgtcgccgataagcccggggtgcactggtactactgcagctggttctgc
cacgccctgcacatggaaatgtgcgggcggatgctggtggaaaaggcttga

DBGET integrated database retrieval system