KEGG   Pseudomonas aeruginosa M18: PAM18_1779Help
Entry
PAM18_1779        CDS       T01973                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAM18_1779 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAM18_1779 (glk)
   00052 Galactose metabolism
    PAM18_1779 (glk)
   00500 Starch and sucrose metabolism
    PAM18_1779 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PAM18_1779 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PAM18_1779 (glk)
   00524 Butirosin and neomycin biosynthesis
    PAM18_1779 (glk)
Enzymes [BR:paf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PAM18_1779 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1942562..1943557
Genome map
AA seq 331 aa AA seqDB search
MNNDNKRSAGGLGLVGDIGGTNARFALWRGQRLESIEVLACADYPRPELAVRDYLARIGE
SVANIDSVCLACAGPVGAADFRFTNNHWVINRAAFREELGLDHLLLVNDFSTMAWAASRL
GADELVQVRAGSAQADRARLIIGPGTGLGVGSLLPLGGGRWEVLPCEGGHVDLPVTSPRD
FALWQGLQARYGHVSAERALSGNGLLALYEISCALDGVAVRASSAAEVGALAMAGDAQAD
AVLEHFFLWLARVAGNAVLTVGALGGVYITGGIVPRFLERFIASGFAEAFASRGKTSGAY
LQDVPVWVMTAEHPGLLGAGVALQQALDAEG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgacaacaagagaagcgccggcggcctcggcctggtcggcgatatcggtggc
accaatgcgcgtttcgcgctctggcgcgggcagcgcctggaatccatcgaggtgctcgcc
tgcgccgactacccgcggcctgaactggccgtgcgcgactacctggcgcggatcggcgaa
tcggtggcgaacatcgactcggtctgcctggcctgcgccggtccggtcggggcggccgat
ttccgtttcaccaacaaccactgggtgatcaatcgtgccgcgttccgcgaggagctgggg
ctggatcacctgctgctggtcaacgacttcagcaccatggcctgggccgcctcgcggcta
ggtgcggacgagctggtgcaggtccgcgccggcagtgcccaggcggatcgcgcccggctg
atcatcggtcccggcaccggccttggtgtcggcagcctgctgccgctgggcgggggacgt
tgggaagtgctgccctgcgagggcgggcacgtcgacctgccggtcacttcgccgcgcgac
ttcgcgctctggcagggcctgcaggcgcgctacggacatgtctccgccgagcgcgcactg
tccggcaacggcctgctcgccctctatgaaatcagctgcgccctggacggggtcgccgta
cgcgcgagcagtgcggcggaagtcggtgccctggccatggccggcgacgcccaggcggac
gccgtgctggagcacttcttcctgtggctggcgcgggtcgccggcaacgcggtgctcacc
gtcggcgcgctcggtggcgtctacattaccggcggcatcgtcccgcgtttcctcgagcgt
ttcatcgccagcggcttcgccgaggccttcgccagccgtggcaagactagcggcgcttac
ctgcaggacgtaccggtgtgggtcatgaccgccgaacatccgggcctgctcggcgccggg
gtcgccctgcagcaggccctggacgccgagggctga

DBGET integrated database retrieval system