KEGG   Pseudomonas aeruginosa M18: PAM18_1946Help
Entry
PAM18_1946        CDS       T01973                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAM18_1946 (fadB)
   01212 Fatty acid metabolism
    PAM18_1946 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PAM18_1946 (fadB)
   00650 Butanoate metabolism
    PAM18_1946 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    PAM18_1946 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    PAM18_1946 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PAM18_1946 (fadB)
   00310 Lysine degradation
    PAM18_1946 (fadB)
   00380 Tryptophan metabolism
    PAM18_1946 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PAM18_1946 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PAM18_1946 (fadB)
   00281 Geraniol degradation
    PAM18_1946 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PAM18_1946 (fadB)
Enzymes [BR:paf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PAM18_1946 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PAM18_1946 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PAM18_1946 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     PAM18_1946 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2141558..2143705
Genome map
AA seq 715 aa AA seqDB search
MIYQGKAITVKPLEGGIVELNFDLKGESVNKFNRLTLSELRAAVDAIKADASVKGVIVTS
GKDVFIVGADITEFVDNFQLPDEELMAGNLEANKIFSDFEDLDVPTVAAINGIALGGGLE
MCLAADFRVMSATAKVGLPEVKLGIYPGFGGTVRLPRLIGCDNAVEWIASGKENKAEDAL
KVGAVDAVVAPEQLQAAALDLAKRAVAGELDHKARRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKSIQKAANFGRDKALEVEAAGFVKLAKTSVAQSLIGLFLNDQEL
KKKAKKYDEVAKDVKLAAVLGAGIMGGGIAYQSALKGTPILMKDIREEGIQMGLNEAAKL
LGKRVEKGRLTPAKMAEALNGIRPTMSYGDFGNVDIVVEAVVENPKVKQAVLAEVEGAVK
EDAIIASNTSTISISLLAQALKRPENFCGMHFFNPVHMMPLVEVIRGEKTGETAIATTVA
YAKKMGKSPIVVNDCPGFLVNRVLFPYFGGFAKLLSFGVDFVRIDKVMEKFGWPMGPAYL
SDVVGIDTGHHGRDVMAEGFPDRMAVEGKTAVDVMYEANRLGQKNGKGFYAYETDKRGKP
KKVTDPQAYEVLKPIVVEQREVTDEDIVNFMMIPLCLETVRCLEDGIVETAAEADMGLIY
GIGFPPFRGGALRYIDSIGVAEFVALADKYAELGALYHPTAKLREMAKNGQKFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaaggtaaagccatcacggttaagcctcttgagggcggcatcgtcgagttg
aatttcgatctcaagggcgagtccgtcaacaagttcaaccgtctcaccctcagtgagttg
cgtgcggcagtcgatgcgatcaaggccgatgcatcggtcaagggcgtgatcgtgaccagc
ggcaaggacgtgttcatcgttggtgccgacatcaccgagttcgttgacaacttccagctg
cccgacgaggaactgatggcgggcaacctcgaagccaacaagatcttcagcgacttcgaa
gacctggacgtacccaccgttgccgcgatcaacggcatcgccctcggcggcggcctggag
atgtgcctggccgcagacttccgcgtgatgagcgcgaccgccaaggtcggcctgccggaa
gtcaagctgggcatctacccgggcttcggcggcaccgtccgcctgccgcgcctgatcggc
tgcgataacgccgtcgagtggatcgcctcgggcaaggaaaacaaggccgaggacgccctg
aaggtcggcgccgtcgacgccgtggtcgctcccgagcaactgcaggccgctgccctcgac
ctggccaagcgcgccgtcgccggcgagctggaccacaaggcacggcgccagccgaagctg
gaaaagctgaagctgaatgcaatcgagcagatgatggccttcgaaaccgccaagggcttc
gtcgccggccaggccggtccgaactacccggcgccggtggaagccatcaagagcatccag
aaggccgccaacttcggccgcgacaaggcgctggaagtcgaagccgccggcttcgtcaag
ctggccaagacctcggtcgcgcagagtctgatcggcctgttcctgaatgaccaggaactg
aagaagaaagccaagaaatacgacgaagtcgccaaggacgtgaaactggccgccgtgctc
ggcgccggcatcatgggcggcggcatcgcctatcagtcggcgctcaagggcaccccgatc
ctgatgaaggatatccgcgaagagggtatccagatgggcctgaacgaggccgccaagctg
ctcggcaagcgcgtcgagaagggtcgcctgaccccggcgaagatggccgaggcgctcaat
ggcatccgtccgaccatgtcctatggcgacttcggcaacgtcgacatcgtcgtcgaagcc
gtcgtcgagaaccccaaggtcaagcaagccgtgctcgccgaagtggaaggcgcggtgaag
gaagacgcgatcatcgcctccaacacctcgaccatctccatcagcctgctggcccaggcg
ctgaagcgtccggaaaacttctgcggcatgcatttcttcaacccggtgcacatgatgccg
ctggtggaagtgatccgtggcgagaagaccggtgaaaccgccatcgccaccaccgtcgcc
tacgccaagaagatgggcaagagcccgatcgtggtcaacgattgccccggcttcctggtc
aaccgtgtgctgttcccgtacttcggcggcttcgccaagctgctgagcttcggcgtcgac
ttcgtgcgcatcgacaaggtgatggagaagttcggctggcccatgggcccggcctacctg
tccgacgtggtcggcatcgacaccggccaccatggccgcgacgtcatggccgagggcttc
ccggaccgcatggcggtcgagggcaagaccgccgtcgacgtgatgtacgaggccaaccgc
ctgggccagaagaacggcaagggcttctacgcttacgagaccgacaagcgcggcaagccg
aagaaggtcaccgatccgcaggcctacgaagtgctcaagccgatcgtggtcgagcagcgc
gaagtgaccgacgaggacatcgtcaacttcatgatgatcccgctgtgcctggaaaccgtg
cgttgcctggaagacggcatcgtcgagaccgctgccgaggccgatatgggcctgatctac
ggcatcggcttcccgcccttccgtggtggtgctctgcgctacatcgattcgatcggtgtc
gccgagttcgtggccctggccgacaagtacgccgagctgggcgcgctgtaccacccgacc
gcgaagctgcgtgaaatggccaagaacggtcagaaattcttcggttaa

DBGET integrated database retrieval system