KEGG   Pseudomonas aeruginosa M18: PAM18_1955Help
Entry
PAM18_1955        CDS       T01973                                 

Gene name
nagZ
Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PAM18_1955 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PAM18_1955 (nagZ)
Enzymes [BR:paf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PAM18_1955 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2151412..2152395
Genome map
AA seq 327 aa AA seqDB search
MLDIGGTWLTAEDRQILRHPEVGGLIIFARNIEHPAQVRELCAAIRAIRPDLLLAVDQEG
GRVQRLRQGFVRLPAMRAIADNPNAEELAEHCGWLMATEVQAVGLDLSFAPVLDLDHQRS
AVVGSRAFEGDPERAALLAGAFIRGMHAAGMAATGKHFPGHGWAEADSHVAIPEDARSLE
EIRRSDLVPFARLAGQLDALMPAHVIYPQVDPQPAGFSRRWLQEILRGELKFDGVIFSDD
LSMAGAHVVGDAASRIEAALAAGCDMGLVCNDRASAELALAALQRLKVTPPSRLQRMRGK
GYANTDYRQQPRWLEALSALRAAQLID
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacatcggcggcacctggctgaccgccgaggaccgccaaatcctgcgccacccc
gaggtgggcgggctgatcatcttcgctcgcaacatcgagcatcctgcccaggttcgcgaa
ctgtgtgcggccattcgcgccatccgtcccgacctgttgctggccgtcgaccaggaagga
gggcgcgtgcagcgcctgcgccagggcttcgtgcgcctgccggcgatgcgcgcgatcgcc
gacaaccccaatgccgaagagctggccgagcattgtggctggctgatggcgaccgaggtg
caggcggtcggcctcgacctgagtttcgcgccggtgctggatctcgaccaccagcgcagc
gccgtggtcggtagccgcgccttcgagggcgacccggagcgtgccgcgctgcttgccggt
gctttcattcgcggcatgcatgccgccgggatggccgccaccggcaagcattttcccggt
cacggctgggccgaggccgattcccatgtggcgattcccgaagacgcgcgcagtctcgag
gaaatccggcgcagcgacctggttccgttcgcccgcctggccggacagctcgacgcgctg
atgccggcccatgtcatctatccgcaggtcgacccgcagcccgccggcttttcccggcgc
tggttgcaggagatcctgcgcggcgagctgaagttcgacggggtgatattcagcgacgac
ctgtcgatggccggcgcccatgtggtcggcgacgccgccagccgcatcgaggccgccctg
gccgcgggctgcgacatgggcctggtgtgcaacgaccgggcttccgccgagctggccctg
gctgccctgcaacgcctgaaggtgaccccgccgtcgcgtctgcaacgcatgcgtggcaag
ggctacgcgaataccgactatcgccagcagccgcgctggctggaagcactgtccgcgttg
cgcgccgcgcaactgattgattga

DBGET integrated database retrieval system