KEGG   Pseudomonas aeruginosa M18: PAM18_2020Help
Entry
PAM18_2020        CDS       T01973                                 

Definition
putative magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAM18_2020
Enzymes [BR:paf01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PAM18_2020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2219262..2220278
Genome map
AA seq 338 aa AA seqDB search
MSATVHYPLSAVVAADELKLALCLAAVDPAIGGVLIEGPRGMAKSTLARGVAELLPAGEF
VTLPLGASEERIVGSLDLDAALGEGRARFSPGVLAKADGGVLYVDEVNLLPDHLVDLLLD
VAASGVNLVERDGISHRHPARFVLIGTMNPEEGELRPQLLDRFGLNVRLDTQLPPAERAE
IIRRRLAFDADPQAFVERWEGQQDTLRRRCAEARRRLARIPLDDAALDSIARRCFEAAVD
GLRADLVWLRAARAHAAWRGGERIEAEDIDAVEHFALLHRRRQSNPPPSAANPPPPPAAA
PVALPERTGDGEGQWGELPARPVAMGTARELPRWPKKP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctaccgtgcattaccccctgtccgccgtggtcgccgccgacgaactgaagctg
gcgctgtgcctggccgcggtcgatccggcgatcggcggggtactgatcgaggggccgcgc
ggaatggccaagtcgaccctggcgcggggcgtcgccgagctgctgccggcgggcgagttc
gttaccctgccgctgggcgccagcgaggagcgcatcgtcggcagcctcgacctggacgcc
gccctcggcgaaggtcgcgcgcggttttccccgggcgtgctggccaaggccgacggcggc
gtgctctacgtcgacgaggtgaacctgctaccggaccacctggtggatttgttgctcgac
gtcgccgccagcggcgtcaacctggtcgagcgcgatggcatttcccaccggcatccggcg
cgtttcgtgctgatcggcacgatgaacccggaagagggcgaactgcgcccgcaactgctc
gaccgtttcggcctcaacgtgcgcctcgacacccagctgccgccggccgagcgggcagag
atcatccgtcgccggctggccttcgatgccgacccgcaggccttcgtcgaacgctgggaa
ggccagcaggacaccctgcgccgccgttgcgccgaggcgcgccggcggctggcgcggatt
cccctggacgatgcggcgctggacagcatcgctcgacgctgcttcgaggcggctgtcgat
ggcctgcgcgccgacctggtctggctgcgcgcggcgcgcgcccatgcggcctggcgcggc
ggcgagcggatcgaggcggaggacatcgatgcggtggaacatttcgccctgctgcatcgc
cgtcgccagtcgaacccgccaccatcggcggccaatccaccgccaccgcccgcggcggcc
cctgtcgcgctcccggagcgcaccggcgacggcgaagggcagtggggcgaattgccggct
cggccggtggccatggggaccgcccgcgagctgccgcgctggccaaaaaagccctga

DBGET integrated database retrieval system