KEGG   Pseudomonas aeruginosa M18: PAM18_2137Help
Entry
PAM18_2137        CDS       T01973                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:paf00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:paf00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2337662..2338147
Genome map
AA seq 161 aa AA seqDB search
MSDSLLSIPCTTIKGEQKTLADFGGKALLVVNTASKCGFTPQYQGLEALWEKYRERGLVV
LGFPCNQFGKQEPGDEGEISQFCELNYGVSFPLFRKIEVNGAGAHPLFVSLKKRAPGLLG
SQGIKWNFTKFLIGRDGQVVKRYAPTTKPEELSSAIEALLE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattcgctgctgagcattccctgcaccaccatcaagggcgaacagaagaccctg
gccgacttcggcggcaaggcgctgctggtggtgaacaccgccagcaagtgcggcttcacc
ccgcagtaccaggggctggaggccttgtgggaaaaataccgtgagcgcggactggtggtg
ctcggtttcccctgcaaccagttcggcaagcaggaaccgggcgacgagggcgagatttcg
cagttctgcgaactgaactacggggtgagcttcccgctgttcaggaagatcgaggtcaac
ggcgccggcgcccacccgttgttcgtcagcctgaagaagcgcgcgccgggcctgctcggc
agccagggcatcaagtggaacttcaccaagttcctgatcggccgcgatggccaggtggtg
aagcgctatgcgccgaccaccaagccggaggagctgagctcggcgatcgaggcgctgctt
gaatga

DBGET integrated database retrieval system