KEGG   Pseudomonas aeruginosa M18: PAM18_2341Help
Entry
PAM18_2341        CDS       T01973                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:paf01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:paf00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2541146..2542741)
Genome map
AA seq 531 aa AA seqDB search
MSAYQNEIKAVAALKEKNGSSWSAINPEYAARMRIQNRFKTGLDIAKYTAAIMRKDMAEY
DADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTNKRYLYLSGWMVAALRSDFGPLPDQSM
HEKTAVSGLIEELYTFLRQADARELDLLFTGLDAARAAGDKAKEAELLAQIDNFETHVVP
IIADIDAGFGNAEATYLLAKKMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHIDFLAKI
NAVRYAFLELGVDDGVIVARTDSLGAGLTKQIAVTNEPGDLGDLYNSFLDCEEISEAELG
NGDVVIKREGKLLRPKRLASNLFQFRKGTGEDRCVLDCITSLQNGADLLWIETEKPHVGQ
IKAMVDRIREVIPNAKLVYNNSPSFNWTLNFRQQVFDAFVAEGKDVSAYDRNKLMSVEYD
DTELAKVADEKIRTFQRDGSAHAGIFHHLITLPTYHTAALSTDNLAKGYFADEGMLAYVK
GVQRQELRQGIACVKHQNMAGSDIGDNHKEYFAGEAALKASGKDNTMNQFH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatatcagaacgagatcaaggcagttgccgcgctgaaagagaagaacggcagc
agctggagcgcgatcaaccccgagtacgcagctcgcatgcgtatccagaaccgcttcaag
accggcctggatatcgccaagtacaccgcggccatcatgcgcaaggacatggccgaatac
gatgcggactcctccgtctacacccagtcgctgggttgctggcacggcttcatcgggcag
cagaagctgatctcgatcaagaagcacctgaagaccaccaacaagcgctacctctacctg
tccggttggatggtcgccgcgctgcgctccgacttcggcccgctgccggaccagtccatg
cacgagaaaaccgcggtttccggcctgatcgaagagctgtacaccttcctgcgccaggct
gacgcccgcgagctggacctgctgttcaccggcctggacgctgcccgcgccgctggcgac
aaggccaaggaagccgagctgctggcccagatcgacaacttcgaaacccacgtggtgccg
atcatcgccgacatcgacgccggcttcggcaacgccgaggcgacctacctgctggccaag
aagatgatcgaagccggcgcctgctgcatccagatcgagaaccaggtgtccgacgagaag
cagtgcggccaccaggacggcaaggtcaccgttccgcacatcgacttcctcgccaagatc
aatgccgtacgctacgccttcctcgagctgggcgtggacgatggcgtgatcgtcgcccgt
accgactccctgggcgccggcctgaccaagcagatcgccgtgaccaacgagccgggcgac
ctgggcgacctgtacaactccttcctggattgcgaagaaatctccgaggccgagctgggc
aacggcgacgtcgtgatcaagcgcgaaggcaagctgctgcgtccgaagcgcctggcttcc
aacctgttccagttccgcaagggcaccggcgaagatcgctgcgtcctggactgcatcacc
tcgctgcagaacggcgccgacctgctctggatcgaaaccgagaagccgcacgtcggccag
atcaaggcaatggtcgatcgcatccgcgaagtgattccgaacgccaagctggtctacaac
aacagcccgtccttcaactggaccctgaacttccgccagcaggtgttcgatgcgttcgtc
gccgaaggcaaggacgtttccgcctacgaccgcaacaagctgatgagcgtcgagtacgac
gacaccgagctggccaaggtcgccgacgagaagatccgcaccttccagcgcgatggctcg
gcccacgccggcatcttccaccacctgatcaccctgccgacctaccacaccgccgcgctg
tccaccgacaacctggccaagggctacttcgccgacgaaggcatgctggcctacgtgaag
ggcgtgcagcgccaggaactgcgccagggcatcgcctgcgtcaagcaccagaacatggcg
ggctccgacatcggcgacaaccataaagagtacttcgctggcgaagccgctctgaaggcc
agcggcaaagacaacaccatgaaccagttccactaa

DBGET integrated database retrieval system