KEGG   Pseudomonas aeruginosa M18: PAM18_2875Help
Entry
PAM18_2875        CDS       T01973                                 

Definition
putative 4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAM18_2875
Enzymes [BR:paf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PAM18_2875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3198902..3200956
Genome map
AA seq 684 aa AA seqDB search
MSDARLAELAAAVGLQLDWQDANGRPQRVDPEVQRGLLEALGYPAQSPQQIEQSLAALAR
LREDSANLGLLVGECGQPLEQALGPAGTPGELVYEDGTRIALRLDAEGRLPAQARSGYAQ
LSLEQREWAVAMAPPSCPSLASLAPGRSRRWGLAAQVYALRRPSDGGLGDSAALEDLLRS
AARHGADALAISPLHALAEANGHAYSPYSPSSRLFFNVLHAAPATILGAAAVEQAIRRAG
LAAEMARLESLELIDWTAAADLRMRLLRQLHRDFTERASPLRHDLAEFRREAGEALLHHC
RFETLQAHLGAGPDWRRWPEPLRRPGEPAVAAFCADHAEEVDFRAFGQWLTQRCLQHAQR
QAREAGMAIGLVADLAVGADGGGSQAWSRQEELLAEVNVGAPPDILNQSGQDWGVSAFNP
EGLRRHGYRAFREMLRANLAWPGGLRIDHVMGLQRLWLIPRGQPPHAGAYLRYPQRELLR
LLALEASRASALVIGEDLGTVPEGLREELARRQVLGTRVLLFERRGERFVPPAQWPADAM
ATTSTHDLPSLSGWWRGRDIHWRGRAGHRSAEECAADLELRAEERRALAASLEPPVDPDP
AAEVPLDACIGYVGATPAPLVLLPLEDALGSLEQPNLPGPGDAHPNWRRRWPENAAQMLG
TPQVDRRLRLLERSRRDAEEAAHD
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgcacgcctggccgaactggccgccgccgtgggcctgcaactcgactggcag
gacgccaacggacggccgcagcgggtcgacccggaggtccagcgcggcctgctggaagca
ctcggctatccggcgcagagtccgcaacagatcgaacagagcctggccgcgctggcccgg
ctgcgcgaggacagcgccaacctcggactgctggtcggcgaatgcggccagccgctggag
caagcgctcggccccgccggcaccccgggcgagctggtctacgaggacggcacgcggatc
gccctgcgcctggacgccgaaggccgcctgccggcgcaggcccgcagtggctatgcgcag
ctgtcgctggagcagcgggaatgggcggtggcgatggcgccgccgagctgtccgtccctg
gccagcctcgccccgggtcgctcgcgtcgctggggtctggccgcccaggtctatgccctg
cgccgccccagcgacggcggcctgggcgacagcgccgccctcgaggacctgctgcgcagc
gccgcgcggcatggcgccgacgcgctggcgatcagcccgctgcacgccctggccgaagcc
aacggacatgcctacagcccctactcgccgtccagccggctgttcttcaatgtcctgcac
gccgcgccggcgaccattctcggcgcggcggcggtggaacaggcgatccgtcgcgccggc
ctggccgcggagatggcccgcctggagagcctggagctgatcgactggacagcggcggcg
gacctgcgcatgcgcctgctgcgccaactccaccgcgacttcaccgagcgcgccagtccc
ttgcgccacgacctcgccgaattccgccgcgaagccggcgaggccctgctgcaccactgc
cgcttcgagaccctgcaggcgcacctgggcgccggccccgactggagacgctggccggag
ccgctgcgccgccccggcgagccggcggtggccgcgttctgcgccgatcacgccgaggaa
gtggacttccgtgccttcggccagtggctgacccaacgttgcctgcaacatgcccagcgc
caggcgcgcgaggccgggatggccatcggtctggtcgccgacctggcggtgggcgccgat
ggcggcggcagccaggcctggtcgcggcaggaagagctgctcgccgaagtgaatgtcggc
gcgccgccggacatcctcaaccagtccggacaggactggggcgtttccgcgttcaatccc
gaaggcctgcgccgccacggctaccgggcattccgcgagatgctgcgggccaacctggcc
tggcccggagggctacgcatcgaccatgtgatgggcctgcaacgtctctggctgatcccg
cgcggccagccgccccacgccggcgcctacctgcgctacccgcaacgcgagctgctgcgc
ctgctggcgctggaggccagtcgcgcctcggcgctggtcatcggcgaggacctcggcacc
gtgcccgaaggcctgcgcgaggaactggcacgccgccaagtgctgggtacccgcgtgctg
ctcttcgagcggcgcggcgaacgcttcgtgcccccggcgcaatggccggcggacgccatg
gccaccaccagcacccacgacctgccgagcctgtccggctggtggcggggccgggacatc
cactggcgcggccgcgccggacaccgcagcgccgaggaatgcgcggccgacctggaactg
cgcgccgaggagcgccgggcgctggccgccagcctcgaaccgccggtcgatcccgacccc
gccgccgaagtaccgctggacgcctgcatcggctatgtcggggcaacccccgcgccgttg
gtgctactgcccctggaggacgccctgggcagcctggagcagccgaacctgcccggcccc
ggcgacgcccacccgaactggcggcggcgctggccggaaaacgccgcgcagatgctcgga
acgccgcaggtcgaccggcgcctgcgcctgctcgaacgcagccgccgggatgccgaggag
gccgcccatgattga

  All links  
No link information was found.   
DBGET integrated database retrieval system