KEGG   Pseudomonas aeruginosa M18: PAM18_2885Help
Entry
PAM18_2885        CDS       T01973                                 

Gene name
glgB
Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:paf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3211896..3214094)
Genome map
AA seq 732 aa AA seqDB search
MSEPMSERERWQLELDKLQRGLQGDPFAFLGPQRDPGGEGGVLRAYLPGAQRVELLDEDG
ATLAELEQSDPGSGLFQRHLERLPPRYRLRVHWPDGVQESEDPYAFGPLLGELDLYLFAE
GNHRQLASCLGAQLTRHEGVEGVRFAVWAPNAVRVSVVGDFNGWDGRRHPMRRRYPSGVW
ELFVPRLGEGELYKYELQGHDGLLPLKADPLALACETPPGTASKTCAALRHEWRDQDWLA
RRAERQGYAAPLSIYEVHAGSWRHRDGRPPHWSELAEELIPYVRQLGFTHIELMPVMEHP
FGGSWGYQPLGLFAPTARYGTPEDFAAFVDACHQAGIGVILDWVPAHFPTDAHGLGRFDG
TALYEYEHPFEGFHQDWDTYIYNLGRSEVHGFMLASALHWLRTYHVDGLRVDAVASMLYR
DYSRKEGEWLPNRHGGRENLEAIDFLHHLNQVVASETPGALVIAEESTAWPGVSRPVAEG
GLGFSHKWNMGWMHDSLAYIGEDPLHRRYHHHQLTFGLLYAFSEHFILPISHDEVVHGKH
SLLDKMPGDRWQKFANLRLYLSFMWSHPGKKLLFMGCEFGQWREWNHDGELDWYLLRYPE
HQGVQDLVAALNRLYRELPALHARDGEALGFEWLIGDDQANSVYAWLRHAAGEPSLLAVH
NFTPVPRQGYRIGVPQGGDWDVLLNSDAQAFAGSGAGSQGRVSSESCGAHGQAQSLVLDL
PPLGTLLLRPAG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaccgatgtccgaacgcgaacgctggcaactggagctggacaagctgcagcgc
ggcctgcagggcgatccattcgccttcctcggcccgcagcgcgaccccggcggcgaaggc
ggcgtgctgcgcgcctacctgcccggcgcgcagcgcgtcgagctgctcgacgaagacggc
gcgacgctcgccgaactggagcagagcgaccccggcagcggcttgttccagcgccacctg
gagcgcctgccaccgcgctaccgcctgcgcgtgcactggccggacggcgtgcaggaaagc
gaagacccctatgccttcgggccgttgctcggcgaactcgacctctacctgttcgccgaa
ggcaaccaccgccaactggcctcctgcctgggcgcgcaactgacccgtcacgaaggcgtg
gagggcgtgcgcttcgcggtctgggcgccgaacgccgtgcgcgtctcggtggtcggcgat
ttcaacggctgggacgggcgtcgtcacccgatgcgacgacgctatccatccggcgtctgg
gaactgttcgtcccgcgcctcggcgagggcgaactgtacaagtacgagttgcagggccac
gacggcctcctgccgctgaaggccgaccccctggcgctggcctgcgagacgccgcccgga
accgcttcgaagacctgcgcggcgttgcgccacgagtggcgcgaccaggactggctggcc
cggcgcgcggagcgccagggctatgcggcaccgctgtcgatctacgaagtccacgccggc
tcctggcgccaccgcgacggccggccgccgcactggtcggaactggcggaggagctgatt
ccctacgtgcgccagctcggcttcacccatatcgagctgatgccggtgatggaacatccc
ttcggcggctcctggggctaccagccgctcgggttgttcgcccccaccgcgcgctacggc
acgccggaggacttcgccgcgttcgtcgacgcctgccaccaggccggcatcggcgtgatc
ctcgactgggtgccggcgcattttcccaccgacgcccacggcctgggccgtttcgacggc
acggcgctgtacgagtacgaacatcccttcgaaggcttccaccaggactgggatacctac
atctacaaccttggccgcagcgaggtgcacggcttcatgctggcctcggcgctgcactgg
ctgcgcacctaccacgtcgacggcctgcgggtggatgcggtggcctcgatgctctatcgc
gactattcgcgcaaggaaggcgaatggctgccgaaccgccatggcggccgggagaacctg
gaggccatcgacttcctccatcacctcaaccaggtggtcgccagcgaaacccccggcgcg
ctggtgatcgccgaggaatccaccgcctggcccggcgtcagccgtccggtggcggagggc
ggcctgggcttcagccataagtggaacatgggctggatgcacgacagcctggcgtacatc
ggcgaagacccgctgcaccggcgctatcaccaccaccagttgaccttcggcctgctctac
gccttctccgagcatttcatcctgccgatctcccacgacgaggtggtacatggcaagcac
tcgctactggacaagatgcccggcgaccgctggcagaagttcgccaacctgcgcctgtac
ctgagcttcatgtggtcgcacccgggcaagaagctgctgttcatgggatgcgagttcggc
cagtggcgcgagtggaaccacgacggcgaactggactggtacctgctgcgctatccggag
catcagggcgtacaggacctggtggcggccctcaaccggctgtaccgcgaactccccgca
ctgcatgcgcgcgacggcgaggcgctcggcttcgaatggctgatcggcgacgaccaggcg
aacagtgtctacgcctggctgcgccacgcggccggcgagccatcgctgctggcggtacac
aatttcaccccggtgccgcgccagggctatcggatcggcgtaccgcaaggcggcgactgg
gacgtgctgctcaatagcgacgcccaggcgttcgccggttccggcgcaggcagccagggc
cgcgtctccagcgagtcgtgcggcgcccatggccaggcgcagtcgctggtgctcgacctg
ccgccgctgggcacgctgctgctgcgtccggccggctga

DBGET integrated database retrieval system