KEGG   Pseudomonas aeruginosa M18: PAM18_2959Help
Entry
PAM18_2959        CDS       T01973                                 

Definition
putative asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAM18_2959
Enzymes [BR:paf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PAM18_2959
Peptidases [BR:paf01002]
 Cysteine Peptidases
  Family C44
   PAM18_2959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3290512..3292344)
Genome map
AA seq 610 aa AA seqDB search
MCGITGWTDWSRDLGEQRSILERMTRTLAPRGPDAEGLWLSRHALLGHRRLAIIDLENGA
QPMLAEAGGRVALTYSGEVYNFRELRAELETLGQVFRTRSDTEVVLRAYLQWGEASFARL
RGIYGFALWDEREQSLWLVRDRFGVKPLYYYPTAGGVLFASEPKAIFANPEANPVLDASG
IAELFALTTAPTPGHGLYKGLRQVRPGQALRFDRNGVRELVYWALRAERHEEGAEDSAER
AGQLLREAVAEQLVADVPLGSLLSGGLDSSAISAFAVAALDGDARRLPTFSVDFPGEGRG
FVPTPWQSSWDEPYAQLAANFLGTPHRTVLVAPEEVLEQDEAVLQARDLPGWGELDASLY
LLFRQVREHTTVALSGESADEVFGGYPFFHDPSALAHDGFPWLAGKSGPWQLLRREVAER
VAAPEYIRARYREALAEVPRLDGEDAAQRRQREVAYLALSRWLPAMLERKDRMSMAVGLE
VRVPFCDHRLVEYVWNLPWALKSVAGESKSLLRRALRGHLPQAILERRKSGFPANPDPRY
LALLRERVGRLLDDGRSPLFELVDAGRVRQALEQGTPLPSPRASASPTAGLAYLLNLDCW
LTRHGVDISL
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcaccggctggaccgactggagccgcgacctcggcgagcagcgcagcatc
ctcgaacgcatgacccgtaccctggccccgcgcgggccggacgccgaaggcctgtggctg
tcgcggcacgcgctgctcggccatcggcgcctggcgatcatcgacctggagaacggcgct
caaccgatgcttgccgaggctggtgggcgggtggcgctgacctacagcggcgaggtctac
aacttccgcgagctgcgcgccgagctggagacgctgggccaggtcttccgcacccgctcg
gacaccgaagtggtgctgcgcgcctatctgcaatggggcgaggcttccttcgcccgcctc
cgcggcatctacggcttcgccctgtgggacgagcgcgagcagagcctgtggctggtgcgc
gatcgcttcggggtcaagccgctgtactactacccgaccgccggaggcgtgctgttcgcc
tcggaacccaaggcgatcttcgccaaccccgaggccaacccggtgctcgacgccagcggc
atcgccgagctgttcgccctgaccaccgcgccgactcccggccacggcctgtacaagggc
ctgcgccaggtccggccgggccaggcgctgcgcttcgaccgcaatggtgtgcgcgagttg
gtctactgggcgctgcgcgcggaacgtcacgaagagggcgccgaggacagcgccgaacgc
gccggccagttgctccgcgaggcggtggccgagcaactggtggccgacgtcccgctgggc
agcctgctttccggcgggctcgactccagcgccatcagtgccttcgcggtggccgcgctg
gatggggacgcgcggcgcctgccgaccttctccgtggacttccccggcgaaggccgcggc
ttcgtcccgacgccctggcaaagcagctgggacgaaccctatgcgcagctggcggcgaac
ttcctcggtacgccgcaccgtaccgtgctggtcgccccggaagaggtgctggaacaggac
gaggcggtgctccaggcccgcgacctgcccggctggggcgagctggacgcctcgctctac
ctgctgttccgccaggtccgcgagcacaccacggtggcactgtcgggcgagtcggccgac
gaggtgttcggcggctacccgttcttccacgacccgagcgccctcgcacacgacggcttc
ccctggctggccggcaagagcgggccctggcaactgctgcggcgggaggtcgccgaacgg
gtggcggcgccggaatacatccgggcgcgctaccgcgaggccctcgccgaagtgccgcgg
ctggatggcgaggatgccgcccagcgacgccagcgcgaggtcgcctacctggcgctgagc
cgctggctgccggcgatgctcgaacgcaaggaccggatgagcatggcggtcggcctggaa
gtgcgcgtgccgttctgcgaccaccgcctggtggagtacgtatggaacctgccctgggcg
ctgaagagcgtcgccggggaaagcaagagcctgctgcgccgggccctgcgcgggcacctg
ccgcaggcgatcctggagcggcgcaagagcggtttcccggccaaccccgacccacgttac
ctggcgctgctgcgcgagcgggtcggccgcctgctcgacgacggccgctcgccgctgttc
gaactggtggacgccgggcgggtccgccaggctctcgaacagggcacgccgctgcccagc
ccgcgtgcctcggcgagcccgaccgccggcctggcctacctgctgaacctggactgctgg
ctgacccgccatggggtcgacatcagcctctga

DBGET integrated database retrieval system