KEGG   Pseudomonas aeruginosa M18: PAM18_3363Help
Entry
PAM18_3363        CDS       T01973                                 

Definition
putative oxidase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PAM18_3363
Enzymes [BR:paf01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PAM18_3363
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PAM18_3363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3745564..3746109)
Genome map
AA seq 181 aa AA seqDB search
MSSLTVYHENQPEQPLKLLTHAEDIASTLAEVGVRFERWEAAAPIAAGASQDEVIAAYAH
EIERLKRERGYITVDVVSLNSDHPQKAELRAKFLDEHRHGEDEVRFFVAGRGLFVLHIEE
HVYAVLCERNDLISVPAGTRHWFDMGEHPHFVAVRLFNNPEGWVAQFTGDDIASRFPLLE
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccttaccgtctatcacgagaaccagccggagcagccgctgaagctgctgacc
catgccgaggacatcgcttcgaccctggccgaggtcggcgtccgtttcgaacgctgggaa
gccgccgcgccgatcgccgccggcgccagccaggacgaggtgatcgccgcctacgcccac
gagatcgagcggctcaagcgcgagcgcggctacatcaccgtggacgtggtcagcctgaac
agcgaccacccgcagaaggccgaattgcgcgccaagttcctcgacgagcaccgccatggc
gaagacgaggtgcgcttcttcgtcgccgggcgcggcctgttcgtcctgcatatcgaggag
catgtctacgccgtgctctgcgagcgcaacgacctgatctctgtgccggccggcacccgc
cactggttcgacatgggcgagcacccgcatttcgtcgccgtgcgcctgttcaacaacccg
gagggctgggtcgcccagttcaccggcgacgacatcgccagccgcttccccctgctggaa
gactga

DBGET integrated database retrieval system