KEGG   Pseudomonas aeruginosa M18: PAM18_3461Help
Entry
PAM18_3461        CDS       T01973                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00020  Citrate cycle (TCA cycle)
paf00310  Lysine degradation
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
paf01120  Microbial metabolism in diverse environments
paf01130  Biosynthesis of antibiotics
paf01200  Carbon metabolism
Module
paf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAM18_3461 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PAM18_3461 (sucB)
Enzymes [BR:paf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PAM18_3461 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H DUF4813
Motif
Other DBs
NCBI-ProteinID: AEO75944
Position
complement(3851501..3852730)
Genome map
AA seq 409 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVIEVLAEADGVLAEII
KNEGDTVLSNELLGKLNEGGAAAPAAPAAAAPAAAPAAQAAAPAAAGGDDAILSPAARKL
AEEAGIDPNSIAGTGKGGRVTKEDVVAAVEAKKNAPAAPAKPAAPAAEAPIFAAGDRVEK
RVPMTRLRAKVAERLVEAQSAMAMLTTFNEVNMKPIMDLRSKYKDLFEKKHNGVRLGFMS
FFVKAATEALKRFPGVNASIDGNDIVYHGYQDIGVAVSSDRGLVVPVLRNAEFMSLAEIE
GGIANFGKKAKEGKLTIEDMTGGTFTISNGGVFGSLLSTPIVNPPQTAILGMHKIQERPM
AVNGQVVILPMMYLALSYDHRLIDGKEAVSFLVAIKDLLEDPARLLLDV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagccccaaccttcccggaatcggtcgccgacggcaccgtcgcc
acctggcacaagaagccgggcgaagcagtcaagcgcgacgaactgatcgtcgacatcgag
accgacaaggtggtcatcgaggttctcgccgaggctgacggcgtgctggccgagatcatc
aagaacgaaggcgacaccgttctgagcaacgagctgctcggcaagctgaacgaaggcggc
gccgccgctccggccgctccggctgccgctgcgcccgccgccgctccggctgcacaggcc
gccgctccggccgccgctggcggcgacgacgccatcctgtccccggccgcgcgcaagctg
gccgaggaagccggcatcgatccgaacagcatcgccggcaccggcaagggcggtcgcgtg
accaaggaagacgtggtcgctgcggtcgaagcgaagaagaacgccccggccgccccggcc
aagcctgccgccccggctgccgaggcgccgatcttcgccgccggcgaccgtgtcgagaag
cgcgtgccgatgacccgcctgcgggccaaggtcgccgagcgcctggtcgaggcgcagtcc
gccatggccatgctgaccaccttcaacgaggtcaacatgaagccgatcatggacctgcgt
tcgaagtacaaggacctgttcgagaagaagcacaacggcgtgcgcctgggcttcatgtcc
ttcttcgtcaaggccgccaccgaggcgctgaagcgcttcccgggggtcaacgcttccatc
gacggtaacgacatcgtctaccacggctaccaggacatcggtgttgccgtttccagcgac
cgcggcctggtggttccggtactgcgtaacgccgagttcatgagcctggccgagatcgag
ggcggcatcgccaacttcggcaagaaggcgaaggaaggcaagctgaccatcgaagacatg
accggcggcaccttcaccatctccaacggtggcgtgttcggttccctgctgtcgaccccg
atcgtcaacccgccgcagaccgccatcctcggcatgcacaagatccaggagcgcccgatg
gccgtgaacggccaggtggtgatcctgccgatgatgtacctggcgctgtcctacgaccac
cgtctgatcgacggcaaggaagcggtgagcttcctggtggcgatcaaggacctgctggaa
gatccggctcgcctgctgctggacgtctga

DBGET integrated database retrieval system