KEGG   Pseudomonas aeruginosa M18: PAM18_3465Help
Entry
PAM18_3465        CDS       T01973                                 

Gene name
sdhD
Definition
succinate dehydrogenase (D subunit)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAM18_3465 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAM18_3465 (sdhD)
   00650 Butanoate metabolism
    PAM18_3465 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PAM18_3465 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3858356..3858556)
Genome map
AA seq 66 aa AA seqDB search
MRIFSLLTLVALSVHAWVGMWTISTDYLTSMALGKAATVVRFLFQAVCGMAMFAFFVWGV
QILWGM
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcttcagcctgttgaccctggttgccctgagcgtccatgcgtgggtcggtatg
tggaccatctccaccgactacctgacttcgatggctctcggcaaggcggcgacagtcgtg
cgtttcctcttccaggcggtttgcggcatggcgatgttcgcattcttcgtctggggtgtg
cagattctttggggtatgtga

DBGET integrated database retrieval system