KEGG   Pseudomonas aeruginosa M18: PAM18_3465Help
Entry
PAM18_3465        CDS       T01973                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase (D subunit)
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00020  Citrate cycle (TCA cycle)
paf00190  Oxidative phosphorylation
paf00650  Butanoate metabolism
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
paf01120  Microbial metabolism in diverse environments
paf01130  Biosynthesis of antibiotics
paf01200  Carbon metabolism
Module
paf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
paf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAM18_3465 (sdhD)
   00650 Butanoate metabolism
    PAM18_3465 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PAM18_3465 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CybS
Motif
Other DBs
NCBI-ProteinID: AEO75948
Position
complement(3858356..3858556)
Genome map
AA seq 66 aa AA seqDB search
MRIFSLLTLVALSVHAWVGMWTISTDYLTSMALGKAATVVRFLFQAVCGMAMFAFFVWGV
QILWGM
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcttcagcctgttgaccctggttgccctgagcgtccatgcgtgggtcggtatg
tggaccatctccaccgactacctgacttcgatggctctcggcaaggcggcgacagtcgtg
cgtttcctcttccaggcggtttgcggcatggcgatgttcgcattcttcgtctggggtgtg
cagattctttggggtatgtga

DBGET integrated database retrieval system