KEGG   Pseudomonas aeruginosa M18: PAM18_3644Help
Entry
PAM18_3644        CDS       T01973                                 

Definition
putative carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:paf00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4052423..4053838
Genome map
AA seq 471 aa AA seqDB search
MRIAALDQGTTSTRVLVASQDGSADIQLALRHQQHHPQSGWVEHDPLELLANLQRCLEAS
GRVDAIGLANQGESCMAWDARSGEPLSPLIVWQDNRTTPHIERLRASGAEALVLERSGLP
LDAYFSASKLGWIVEHLPAARRALKAGRLRLGTSDAWFLDRLCGTFATDVTTASRTALMN
LAEGRWDPDLCALFGVPIECLPEIRDTVGHFGVIGNTPLTASVVDQQASLYGHGCRQPGD
AKITFGTGAFALTLSGERIIRSPETGLLATIAWQIDGKPVYAMDGGVYDASAAVEWAGRL
GLFSDFSELAGFDRPPAIERGLAFVPALSGLACPHWDRSAGAMWLGMDAGTRREDLCQAL
LEGVVLRSAEVIQAMDGYLKVTDRLSIDGGLARSPYFAQFLSDSLQRRIVTQRFDELTAF
GCAALAARGLGYELAEPRNTRTEFQPRVDAGTARRWQVRFSEAVARTRGWR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgccgccctcgaccagggaaccaccagtacccgcgtgctggtcgccagccag
gacggcagcgccgatattcagttggcgctgcgtcaccagcaacaccatccgcagtccggc
tgggtcgagcacgatccgctggaactgctggccaacctgcaacgctgcctggaggccagc
ggccgggtcgacgccatcggcctcgccaaccagggcgaaagctgcatggcctgggacgcc
cgcagcggcgagccgttgtcgccgctgatcgtctggcaggacaaccgcaccaccccgcac
atcgagcgtctacgcgccagcggcgccgaggctctggtcctggaacgcagcggcctgccg
ctcgacgcctatttctcggccagcaagctgggctggatcgtcgagcaccttcctgccgct
cgcagggctttgaaggcaggccgcctgcgcctgggaaccagcgatgcctggtttctcgac
cgcttgtgcggaaccttcgccaccgacgtcaccaccgcctcgcgtaccgcattgatgaac
ctcgccgagggccgctgggaccccgacctgtgcgccctgttcggcgtgccgatcgagtgc
ctgccggaaatccgcgataccgtcggccatttcggggtgatcggcaacaccccgctgacg
gcctcggtggtcgaccagcaggcctcgctctacggtcacggctgccgccagcccggtgat
gcgaagatcaccttcggcaccggcgccttcgccctgactctcagcggcgagcggatcatc
cgctcgccggagacaggcctgctcgccaccatcgcctggcagatcgatggcaaaccggtg
tacgccatggacggcggggtctacgacgccagcgccgcggtcgagtgggccgggcgtctc
ggcctgttcagcgacttctcggaactggccggcttcgaccggccgccggccatcgagcgc
ggcctggccttcgtcccggccctgtcgggactcgcatgcccgcactgggaccgcagcgcc
ggcgcgatgtggctgggaatggacgccggcacccgccgcgaggacctctgccaggccctg
ctcgaaggcgtggtgctacgcagcgccgaggtgatccaggcgatggacggctacctgaag
gtcaccgaccgcctgtccatcgacggcggcctggcgcgcagcccctacttcgcccagttc
ctctccgacagcctgcaacggcgcatcgtcacccagcgcttcgacgaactcaccgccttc
ggttgcgccgcccttgccgcgcgtggcctcggctacgagctggcggagccgcgcaacacc
cgcacggagttccagccgcgggtcgacgccggcaccgcccggcgctggcaggtgcgtttc
agcgaagcggtggcgcgcacccgcggctggcgctga

DBGET integrated database retrieval system