KEGG   Pseudomonas aeruginosa M18: PAM18_3672Help
Entry
PAM18_3672        CDS       T01973                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:paf00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PAM18_3672
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PAM18_3672
Enzymes [BR:paf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PAM18_3672
Two-component system [BR:paf02022]
 CheA family
  CheA-CheYBV
   PAM18_3672
Bacterial motility proteins [BR:paf02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PAM18_3672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4076039..4077145)
Genome map
AA seq 368 aa AA seqDB search
MAVKVLVVDDSGFFRRRVSEILSADGQIQVVGTATNGREAIEQALALRPDVITMDYEMPL
MDGITAVRNIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPDKVRQ
LLCEKVLTIARSNRRSISLPPLPSATSSSHAPASSSSVGASARVGAGASPAPASTSAAPK
RKAYRLVAIGTSTGGPVALQRVLTQLPANFPAPLVLIQHMPAAFTKAFAERLDKLCRINV
KEAEDGDILRPGLALLAPGGKQMMVDGRGTVRILPGDERLNYKPCVDVTFGSAAKAYNDK
VLAVVLTGMGADGREGARLLKQGGSQVWAQDEASCVIYGMPMAVVKANLADAVYGLDDIG
RHLVEACQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaagtcctggtggtggacgattcggggttcttccgccgccgtgtctcggag
attctctccgccgatggacagatccaggtggtcggcaccgccaccaatggccgcgaggcc
atcgagcaggcgctggccctgagacccgatgtgatcaccatggattacgagatgccgctg
atggacggcatcaccgcggtacgcaacatcatgcagcgttgcccgaccccggtcctgatg
ttctcctcgctgacccacgagggcgcgcgggtgaccctggatgcactggacgctggagcg
gtcgattacctgccgaagaatttcgaggacatctcgcgcaacccggacaaggtccgccag
ttgctctgcgagaaggtcctgaccatcgcccgtagcaatcgtcgctcgatcagcctgccg
ccgctgccttcggccacctcgtccagccatgcgccggcgtcgtcctccagcgtcggcgcg
agcgcgcgtgttggtgccggcgcgtcgccggccccggcgtcgacctcggcggcgccgaag
cgcaaggcctaccggctggtcgcgatcggtacctccaccggtggaccggttgccttgcag
cgggtgctgacccagttgccggccaacttcccggcgccgctggtactgatccagcacatg
ccggcggccttcaccaaggccttcgccgagcgcctcgacaagctgtgccggatcaacgtc
aaggaggcggaggacggcgacatcctgcgtcccggcctggcgctgctggcgccgggcggc
aagcagatgatggtcgacggccgcggcacggtgcgcatcctccccggcgacgaacgcctg
aactacaagccctgcgtcgacgtgaccttcggctcggcggccaaggcctacaacgacaag
gtcctggcggtggtcctcaccggcatgggcgccgacgggcgcgagggtgcgcgcctgctc
aagcagggcggcagccaggtgtgggcgcaggacgaggccagttgcgtgatctacgggatg
ccgatggccgtggtcaaggccaacctggcggacgcggtgtacgggctcgacgacatcggc
cggcacctggtcgaggcgtgccagtaa

DBGET integrated database retrieval system