KEGG   Pseudomonas aeruginosa M18: PAM18_3871Help
Entry
PAM18_3871        CDS       T01973                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAM18_3871 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    PAM18_3871 (dapE)
Enzymes [BR:paf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PAM18_3871 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4298804..4299955
Genome map
AA seq 383 aa AA seqDB search
MTASSPSLSPTLELACELIRRPSVTPLDANCQALMMRRLEAAGFALEPMRIEEVDNFWAR
RGGDGPVLCFAGHTDVVPTGPLQAWQHQPFDALIDDQGMLCGRGAADMKGSLASMIVAVE
RFVADHPKHKGAIAFLITSDEEGPAHHGTKAVVERLAARGERLDWCIVGEPSSTSLVGDV
VKNGRRGSLGAKLTIRGVQGHVAYPHLAKNPIHLAAPALAELAVEHWDDGNAFFPPTSFQ
VSNLNSGTGATNVIPGELTALFNFRFSTESTVEGLQKRVEAILDKHGLDWHVEWALSGLP
FLTEPGELLDAVAASIRAVTGRETQPSTSGGTSDGRFIATMGTQVVELGPVNATIHQVNE
RVLASDLELLTEIYYQTLVRLLA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctcttcgccgagtctctcgccgaccctcgaactcgcctgcgagttgatccgc
cgcccctccgtcacgcccctcgacgccaactgccaggccctgatgatgcgccgcctggaa
gccgccggcttcgccctggagccgatgcgcatcgaggaggtggacaacttctgggcacgg
cgcggcggcgacggcccggtgctgtgcttcgccgggcacaccgacgtggtccccaccggc
ccgctgcaggcctggcagcatcaacccttcgacgccctgatcgacgaccagggcatgctc
tgcggacgcggcgcagcggacatgaaaggcagcctggcgtcgatgatcgtcgccgtcgag
cgcttcgtcgccgaccacccgaagcacaagggcgccatcgccttcctcatcaccagcgac
gaggaaggcccggcccaccacggcaccaaggcggtggtcgaacgcctcgccgcacgcggc
gagcgcctggactggtgcatcgtcggcgaaccgtcgagcaccagcctggtcggcgacgtg
gtgaagaacggccgccgcggctccctcggcgccaagctgaccatccgcggcgtacagggc
catgtggcctacccgcacctggcgaagaacccgatccacctggccgccccggcgctggcc
gaactggcggtggaacactgggacgacggcaatgccttcttcccgccgaccagcttccag
gtttccaacctgaactccggcaccggcgccaccaacgtcatccccggcgaactgaccgcg
ctgttcaacttccgcttctccaccgaatccaccgtcgaaggcctgcagaaacgcgtcgag
gcgatcctcgacaagcacggcctggactggcacgtcgaatgggcgctgtccggcctgccg
ttcctcaccgagccgggcgaactgctcgatgcggtggccgccagcatcagggcggtcacc
ggccgcgagacccagccctcgaccagcggcggcacctccgacggacgcttcatcgccacc
atgggcacccaggtggtcgaactcggcccggtcaacgccaccatccaccaggtcaacgag
cgggtcctggccagcgacctggagctgctcaccgaaatctactaccagaccctggtgagg
ctgctcgcctga

DBGET integrated database retrieval system