KEGG   Pseudomonas aeruginosa M18: PAM18_4202Help
Entry
PAM18_4202        CDS       T01973                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PAM18_4202
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PAM18_4202
Enzymes [BR:paf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PAM18_4202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4643925..4644407)
Genome map
AA seq 160 aa AA seqDB search
MSAFHDLTLQGLDGQDLPLSPFKGKVLLVVNVASKCGLTPQYAGLENLYQTYRERGFAVL
GVPCNQFAGQEPGSEADIQSFCSLNYGVSFPMSAKVEVNGSARHPLYRLLAGEGAEFPGD
ITWNFEKFLLGPDGRVLARFSPRTAPDDPALVQAIEKALG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcctttcacgatctcaccctgcaggggttggatggacaggacctgccgctttcc
ccgttcaagggcaaggtgctgctggtggtcaatgtcgcctccaaatgcggcctgacaccc
cagtacgccggcctggagaatctctaccagacctaccgcgagcgcggtttcgcggtgctc
ggcgtgccctgcaaccagttcgccgggcaggagccgggcagcgaggcggatatccagtcc
ttctgcagcctgaactatggcgtcagcttcccgatgagcgccaaggtcgaggtcaacggc
agcgcgcggcatccgctctatcgcctgctggcgggcgagggcgcggagtttcccggcgac
atcacctggaacttcgagaaattcctgctcggtcccgacggtcgcgtgctggcgcgtttc
agcccgcgcacggcgccggacgacccggccctggtgcaagccatcgagaaggccctgggt
tga

DBGET integrated database retrieval system