KEGG   Pseudomonas aeruginosa M18: PAM18_4372Help
Entry
PAM18_4372        CDS       T01973                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:paf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PAM18_4372 (recD)
Enzymes [BR:paf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PAM18_4372 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4838282..4840447)
Genome map
AA seq 721 aa AA seqDB search
MNPTLKQLAGEVRDGRDDQVAQPLAARHDLLRQLDLWVARGWLRALDRAFVAFLVELQPQ
ADPRVLLAAALTSHQLGHGHVCLDLEATLGAPDAALSLPPEGDEGRDVLLPSQLLHGVRL
DAWREALAASPLVEVVDERPGDPEPSETATSPLVLCAQRLYLRRYWRHELEIALALRERL
GRQAPLAADLAPRLAALFAQAPTEDGQRVTDWQKLACALAARGYFSLITGGPGTGKTTTV
VRLLGLLQAPAVAAGQPLRIRLAAPTGKAAARLSESIGQQVRALPLAEDVLQAIPAEVTT
LHRLLGSRPDTRHFRHHRDNPLALDVLVVDEASMIDLEMMASLLDALPPQARLILLGDKD
QLASVEAGAVLGDLCRDAEEGWYSAETRAWLQRVSGETWQGLREGSAQAHPLAQQTVMLR
HSRRFGASSGIGRLARLVNRQQAGDARALLDSPPADLFDLRLRGERDAAFARLFVDGHPQ
APGTPYGYRHYLQRLAEGRPAAGLALEDGAWERWAQSVLTAFDAFRLLCALRRGPWGVEG
LNQRVAAELLRLGLIEADHGWYEGRPVLVTRNDYSLGLMNGDIGIALRLPERNDDGSLRF
ALRVAFPRNDGSGGVRFVLPSRLVEVDTVFAMTVHKSQGSEFAHTALVLPDALNPVLTKE
LVYTGITRARDWFSLVESLPGVFEEAVRRKVRRLSGLMLHLRPEREEQPPHAPGEQTELP
F
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgaccctcaagcaactggccggcgaagtccgcgatggccgcgacgaccaggta
gcgcaaccgctggcggcacgccacgacctgctgcgccagctcgacctgtgggtggcgcgc
ggctggctacgggcgctggaccgggcgttcgtcgccttcctcgtcgagttgcagccgcag
gccgatccccgggtgctgctggcggcggcgctgaccagccaccaactgggccacggtcac
gtctgcctggacctggaggcgaccctcggcgcgcccgacgcggcactgtcgctgccgccg
gaaggcgacgaaggccgcgatgtgctgttgccgtcgcaactgctgcacggcgtgcgcctc
gacgcctggcgcgaggccctggcggcgtcaccgttggtggaggtggtcgacgagcgccca
ggcgatcccgagccgagcgagacggcgacctcgccgctggtgctttgcgcccagcgtctc
tacctgcgtcgttattggcggcacgaactggagatcgccctggccctgcgcgagcgcctg
ggtcggcaggcgcccctggccgccgacctggcgccgcgcctggccgcgctgttcgcgcag
gcgccgacggaagacggccagcgcgtcaccgactggcagaagctggcctgtgccctggcg
gcccgcggctatttcagcctgatcaccggcggtcccggtaccggcaagaccaccaccgtg
gtgcgcctgctcggtctgctccaggcaccggcggtagccgccggccagccgctgcgcatc
cgcctcgcggcacccaccggcaaggccgcggcgcgtctctccgagtccatcggccagcag
gtccgggccctgccgctggcggaagacgtgttgcaggcgatccccgccgaggtcactacc
ctgcaccgtctgctcggcagccgtccggatacccggcacttccgccaccaccgggacaac
cctttggcgctggacgtgctggtggtggatgaggcctcgatgatcgacctggaaatgatg
gccagcctgctcgatgcgctaccgccgcaggcgcgcctgatcctgctcggcgacaaggac
cagttggcctcggtagaggccggcgcggtgctcggcgatctctgccgggatgccgaggag
ggctggtacagcgccgagacccgcgcctggttgcagcgggtcagcggcgaaacctggcag
ggcttgcgcgaaggttcggcgcaggcgcatccgctggcgcaacagaccgtcatgctgcgg
cattcccggcgcttcggcgcgagcagcgggatcgggcgcctggcgcggttggtcaaccgg
caacaggccggcgacgcgcgcgcgctgctggacagtccgcccgccgacctcttcgacctg
cgcctgcgcggggagcgcgatgcagccttcgcccggctgttcgtcgacggtcatccgcag
gcgccgggcacgccgtacggctaccggcactacctgcaacgcctggccgagggccgcccg
gccgccggactggcgctggaggatggcgcctgggagcgctgggcgcagtcggtactgacg
gctttcgacgccttccgcctgctctgcgcgctgcgccgcggcccatggggcgtggaagga
ctgaaccagcgggtagcggcagaactgctgcgccttggcctgatcgaggccgatcacggc
tggtacgaggggcggccggtactggtgacgcgcaacgactacagcctggggctgatgaac
ggcgatatcggtatcgccctgcgcctgcccgagcgcaacgacgacggcagcctgcgcttc
gcgctgcgcgtggccttcccgcgcaacgacggtagcggcggcgtgcgcttcgtcctgccg
agccgcctggtcgaggtggacaccgtgttcgccatgaccgtgcacaagtcgcagggttcg
gagttcgcccataccgcgctggtcctgccggacgcgctgaacccggtgctgaccaaggag
ctggtgtacaccggtatcacccgcgcccgcgactggttcagcctggtggaaagcctgccc
ggggtgttcgaggaagcagtgcggcgcaaggtgcgccggctcagcgggctgatgctgcat
ctgcggccggaaagggaagagcagccgccgcatgctccgggtgaacagaccgagctgccg
ttctga

DBGET integrated database retrieval system