KEGG   Pseudomonas aeruginosa M18: PAM18_4836Help
Entry
PAM18_4836        CDS       T01973                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PAM18_4836 (folK)
Enzymes [BR:paf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PAM18_4836 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5363625..5364113
Genome map
AA seq 162 aa AA seqDB search
MIQRVYVALGSNLAEPREQIQAALDAFERLPETRLVAVSPLYISDPLGPADQPRFVNGVA
ALDTNLAPLDLLDALQAIELEQGRVRDLRWGPRTLDLDILLFGEQLLDLPRLKVPHYHMQ
ARAFVLYPLADLAPDLRLPDGRHLPELLAACPFEGIERLPGA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatccagcgcgtctacgtggcgctgggcagcaacctggccgaaccgcgcgagcagatc
caggctgccctcgatgccttcgagcggcttcccgagacccgcctggtcgccgtctcgccg
ctctatatcagcgacccgctcggccccgccgaccagccgcgcttcgtcaacggcgtggcg
gccctcgacaccaacctggcgccgctcgacctgctcgacgccctgcaggccatcgaactg
gaacaggggcgcgtccgcgacctgcgctggggtccgcgcacgctcgacctggacatcctg
ctgttcggcgaacaattgctcgacctgccgcgcctgaaggtgccgcactaccacatgcag
gcgcgcgctttcgtgctctatcccctcgccgatctcgcccccgacctgcgcctgcccgat
ggccgccacctgccggagctgctcgcggcctgtccgttcgagggcatcgaacgccttccg
ggcgcctga

DBGET integrated database retrieval system