KEGG   Pseudomonas aeruginosa M18: PAM18_4856Help
Entry
PAM18_4856        CDS       T01973                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAM18_4856 (tpiA)
   01230 Biosynthesis of amino acids
    PAM18_4856 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAM18_4856 (tpiA)
   00051 Fructose and mannose metabolism
    PAM18_4856 (tpiA)
   00562 Inositol phosphate metabolism
    PAM18_4856 (tpiA)
Enzymes [BR:paf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PAM18_4856 (tpiA)
Exosome [BR:paf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PAM18_4856 (tpiA)
  Exosomal proteins of bladder cancer cells
   PAM18_4856 (tpiA)
  Exosomal proteins of melanoma cells
   PAM18_4856 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5385648..5386349)
Genome map
AA seq 233 aa AA seqDB search
MAELIKGLRQLALPSGVDVAVMPPCLFISQVIQGLAGKAIDVGAQNSAVEPMQGALTGET
APSQLADVGCSMVLVGHSERRLILGESDEVVSRKFAAAQSCGLVPVLCVGETRAEREAGK
TLEVVARQLGSVIDELGVGAFARAVVAYEPVWAIGTGLTASPAQAQEVHAAIRAQLAAEN
AEVAKGVRLLYGGSVKAASAAELFGMPDIDGGLVGGASLNADEFGAICRAAGS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagttgatcaaaggcttgcgtcagctggcgttgccgagcggagtcgatgtagct
gtgatgccgccttgcttgttcatcagccaggtcatccagggcctggccggcaaggcgatc
gatgtaggtgcgcagaacagcgccgtcgagccgatgcaaggcgcgctgaccggtgagact
gctcccagtcagttggcggatgtcggttgtagcatggtccttgtaggccactcggagcgt
cgcctgattctcggcgagagtgacgaggttgtgagtcgcaagtttgccgcggctcagtcg
tgcggcctggtgccggtgctgtgtgtcggggagacccgggcggagcgcgaggcgggcaag
acgctggaggttgtcgcaaggcagctgggaagcgtgatcgacgagttgggtgttggagct
tttgctcgcgcagtcgtggcttacgagccggtctgggcgatcgggaccgggttgaccgcg
tcccccgcgcaagcccaggaagtgcacgcggcgatccgcgcgcaactggcagcggaaaat
gccgaggtcgcaaaaggtgtgcgactcctttacggcggcagtgtaaaggcggcaagtgca
gccgagttgttcggcatgccggatatcgatggggggctggtaggtggagcctccctcaat
gcggatgagttcggcgcgatctgtcgtgccgcgggaagctga

DBGET integrated database retrieval system