KEGG   Pseudomonas aeruginosa M18: PAM18_5029Help
Entry
PAM18_5029        CDS       T01973                                 

Gene name
pncA
Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PAM18_5029 (pncA)
Enzymes [BR:paf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PAM18_5029 (pncA)
    3.5.1.-  
     PAM18_5029 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5568941..5569600
Genome map
AA seq 219 aa AA seqDB search
MNRPSKIASFDVDAQKGFTPLCADELPVPGGDAIGAALNQLASRAALRLGSKDAHSPKAA
WVVESAEQMLRPLTYPDADLTWVSHCVPGTPGFELLDELPRPIDYDFFVWKGVEPDLHPY
GACYHDLAERRSTGVIEYLRQNGVSHVLVGGLALDYCVKNTALQLRRAGFEVLLYLPACR
AIAEDTAQRACDEMRDAGVILCADLERLDSALAGADKEK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtcccagcaagatcgccagcttcgatgtcgacgcccagaaaggcttcaccccg
ctgtgcgcggacgaactgccggtgcccggcggcgacgccatcggcgccgccctcaaccaa
ctggccagccgcgccgcgctgcgcctgggcagcaaggacgcgcacagcccgaaggctgcc
tgggtagtggaaagcgccgagcagatgctgcggccgctgacctatccggatgccgacctg
acctgggtgagccactgcgtaccgggtacgccgggtttcgagctgctcgacgaactgccg
cggccgatcgactacgacttcttcgtctggaagggcgtggagccggacctgcatccctac
ggcgcctgctaccacgatctggcggaacgccgcagcaccggggtcatcgaatacctgagg
cagaatggcgtgagccatgtgctggtgggtggcctggcgctggactactgcgtgaagaac
accgccctgcaactgcgccgcgccggtttcgaggtgctgctctacctgcccgcctgccgg
gccatcgccgaggacaccgcgcagcgggcctgcgacgagatgcgcgacgccggggtgatc
ctctgcgccgacctggaacgactggatagcgccctcgccggcgccgacaaggagaagtga

DBGET integrated database retrieval system