KEGG   Pseudomonas aeruginosa M18: PAM18_5130Help
Entry
PAM18_5130        CDS       T01973                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00010  Glycolysis / Gluconeogenesis
paf00020  Citrate cycle (TCA cycle)
paf00620  Pyruvate metabolism
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
paf01120  Microbial metabolism in diverse environments
paf01130  Biosynthesis of antibiotics
paf01200  Carbon metabolism
Module
paf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAM18_5130 (aceF)
   00020 Citrate cycle (TCA cycle)
    PAM18_5130 (aceF)
   00620 Pyruvate metabolism
    PAM18_5130 (aceF)
Enzymes [BR:paf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PAM18_5130 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H RnfC_N HlyD_D23 PYNP_C NQRA HlyD_3 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: AEO77608
Position
5692406..5694049
Genome map
AA seq 547 aa AA seqDB search
MSELIRVPDIGNGEGEVIELLVKPGDKVEADQSLLTLESDKASMEIPSPKAGVVKSIKAK
VGDTLKEGDEILELEVEGGEQPAEAKAEAAPAQPEAPKAEAPAPAPSESKPAAPAAASVQ
DIKVPDIGSAGKANVIEVMVKAGDTVEADQSLITLESDKASMEIPSPASGVVESVSIKVG
DEVGTGDLILKLKVEGAAPAAEEQPAAAPAQAAAPAAEQKPAAAAPAPAKADTPAPVGAP
SRDGAKVHAGPAVRMLAREFGVELSEVKASGPKGRILKEDVQVFVKEQLQRAKSGGAGAT
GGAGIPPIPEVDFSKFGEVEEVAMTRLMQVGAANLHRSWLNVPHVTQFDQSDITDMEAFR
VAQKAAAEKAGVKLTVLPILLKACAHLLKELPDFNSSLAPSGKALIRKKYVHIGFAVDTP
DGLLVPVIRDVDRKSLLQLAAEAAELADKARNKKLSADAMQGACFTISSLGHIGGTGFTP
IVNAPEVAILGVSKATMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGELLA
DIRTLLL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaactcattcgcgtacccgacatcggcaacggtgagggtgaagtcatcgagctg
ctggtcaagcccggcgacaaggtcgaggccgatcagagcctgctgaccctggaatccgac
aaggccagcatggaaatccccagtcccaaggccggggtagtgaaaagcatcaaggcgaag
gtcggcgacaccttgaaagaaggtgacgaaatcctcgagctggaagtggaaggcggcgaa
cagcctgccgaagccaaggccgaggcagcgcccgcccaaccggaagcgccgaaagccgaa
gcgcctgctcccgccccgagcgagagcaagccggccgcccccgccgcggccagcgtccag
gacatcaaggtcccggacatcggctcggccggcaaggccaacgtcatcgaagtgatggtc
aaggccggcgacacggtcgaggccgaccagtcgctgatcaccctggaatccgacaaggcc
agcatggagattccctcgccggcctccggggtggtggaaagcgtctcgatcaaggtcggt
gacgaagtcggcaccggcgacctgatcctcaagctgaaggtggaaggcgccgctccggca
gccgaagagcaaccggcagccgctccggcccaggccgcggcgcccgccgccgagcagaag
cccgccgcggcggcccctgcgccagccaaggccgataccccggctccggtcggcgcaccc
agccgcgacggcgccaaggtccacgccggcccggcggtgcgcatgctggcgcgcgagttc
ggcgtcgagctgagcgaagtgaaagccagcggtcccaagggtcgcatcctcaaggaagac
gtccaggtcttcgtcaaggagcaactgcagcgcgccaagtccggcggtgccggcgccacc
ggcggagccggcatcccgccgatcccggaagtcgacttcagcaagttcggcgaagtggaa
gaagtggcgatgacccgcctgatgcaggtcggcgccgccaacctgcatcgcagctggctg
aacgtgccgcacgtgacccagttcgaccagtcggacatcaccgacatggaagccttccgc
gttgcccagaaggccgcggcggagaaggccggggtcaagctgaccgtactgccgatcctg
ctcaaggcctgcgcccacctgctcaaggaactgccggacttcaacagttcgctggccccc
agcggcaaggcgctgatccgcaagaagtacgtacacatcggcttcgccgtggacactccg
gacggcctgctggtcccggtgatccgcgatgtcgaccggaagagcctcctgcaactggcc
gccgaggccgccgagctggccgacaaggcccgcaacaagaagctctcggccgatgccatg
cagggcgcctgcttcaccatctccagtctcggccacatcggcggcaccggcttcacgccg
atcgtcaacgcgccggaagtggcgatcctcggtgtgtccaaggcgaccatgcagccggta
tgggacggcaaggccttccagccgcgcctgatgctgccgctgtcgctgtcctacgaccat
cgcgtgatcaacggtgccgccgcggcgcgcttcaccaagcgcctgggcgagctgctggcg
gacatccgcaccctgctcctgtaa

DBGET integrated database retrieval system