KEGG   Pseudomonas aeruginosa M18: PAM18_5379Help
Entry
PAM18_5379        CDS       T01973                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAM18_5379 (hemD)
Enzymes [BR:paf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PAM18_5379 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(5975584..5976339)
Genome map
AA seq 251 aa AA seqDB search
MSGWRLLLTRPDEECAALAASLGEAGVHSSSLPLLAIDPLEETPEQRTLMLDLDRYCAVV
VVSKPAARLGLERLDRYWPQPPQQTWCSVGAATAAILEAYGLDVTYPEQGDDSEALLALP
AFQDSLRVHDPKVLIMRGEGGREFLAERLRGQGVQVDYLPLYRRRAPDYPAGELLARVRA
ERLNGLVVSSGQGLQNLYQLAAADWPEIGRLPLFVPSPRVAEMARELGAQRVIDCRGASA
PALLAALTSAA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggctggcggctcctgctgacgcgccccgacgaggagtgcgcggccctggccgcc
agcctcggcgaggcgggcgtccatagcagcagcctgccgctgttggcgatcgatccgctg
gaagaaaccccggagcagcgtacgctgatgctcgacctggaccgctactgcgcggtggtg
gtggtcagcaagccggcggcgcgcctggggctggagcggctcgaccgctactggccgcag
ccgccgcagcagacctggtgcagcgtcggcgcggcgaccgcggcgatcctcgaggcctac
ggcctcgacgtaacctaccctgaacagggcgacgacagcgaagcgttgctggcgctgccg
gcgttccaggattccctgcgcgtgcacgatccgaaagtgctgatcatgcgcggcgaaggt
ggccgagaattcctcgccgagcgcctgcgcggccaaggcgtgcaggtggactacctgcca
ctctaccggcgccgggctccggactatccggccggagagctgctggcaagggtgcgggcg
gaacgcctgaacggcctggtggtcagcagtggacagggtttgcaaaatctgtatcagttg
gcggcagccgattggcccgagataggccggttgccgctgttcgtacccagcccgcgggtc
gccgagatggcgcgcgaactgggtgcgcaacgggtgattgattgccggggcgcgagcgcg
ccggccttgctggcggccctgacgagcgccgcctag

DBGET integrated database retrieval system