KEGG   Pseudomonas aeruginosa M18: PAM18_5442Help
Entry
PAM18_5442        CDS       T01973                                 

Gene name
algC
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAM18_5442 (algC)
   00030 Pentose phosphate pathway
    PAM18_5442 (algC)
   00051 Fructose and mannose metabolism
    PAM18_5442 (algC)
   00052 Galactose metabolism
    PAM18_5442 (algC)
   00500 Starch and sucrose metabolism
    PAM18_5442 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    PAM18_5442 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    PAM18_5442 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PAM18_5442 (algC)
Enzymes [BR:paf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PAM18_5442 (algC)
    5.4.2.8  phosphomannomutase
     PAM18_5442 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
6046045..6048636
Genome map
AA seq 863 aa AA seqDB search
MKLFQRTAKDGNELGDLLEPEKKPRKAASERADGKDLLPGIGASLLGVAAAGALLWFGVF
GGAGEAQQRQLDAAWAEGQAGALRQALQQLAADTRAAAASPLALEALQSGDAARIEAAQR
SLLAWDGVVDAHLNAPGQAAQDNDSPGPVSFAALDILHRVESGQNVAAEAYKVGQRWLLY
SAAPVRGADQSLQGTLLLAVDLQRLLRALPPLPGDAGQVQLVQQFSGAPAQVLLQRGTPA
PGKGAQALDSGNPNWKLNYTPGSVASTQASPLLLALAALLALLGGILGTYLTRSSLLRRL
HQDVLTLGQYLQELGGQRTAKPPVPSLPGFAPLIQALARQPRRKPEPTSVPSPAKAAPVA
KAPPREEPALADPLFQNTDILDIDILDEDQDLLGLEQTPIMSTAKAPTLPASIFRAYDIR
GVVGDTLTAETAYWIGRAIGSESLARGEPCVAVGRDGRLSGPELVKQLIQGLVDCGCQVS
DVGMVPTPVLYYAANVLEGKSGVMLTGSHNPPDYNGFKIVVAGETLANEQIQALRERIEK
NDLASGVGSVEQVDILPRYFKQIRDDIAMAKPMKVVVDCGNGVAGVIAPQLIEALGCSVI
PLYCEVDGNFPNHHPDPGKPENLKDLIAKVKAENADLGLAFDGDGDRVGVVTNTGTIIYP
DRLLMLFAKDVVSRNPGADIIFDVKCTRRLIALISGYGGRPVMWKTGHSLIKKKMKETGA
LLAGEMSGHVFFKERWFGFDDGIYSAARLLEILSQDQRDSEHVFSAFPSDISTPEINITV
TEDSKFAIIEALQRDAQWGEGNITTLDGVRVDYPKGWGLVRASNTTPVLVLRFEADTEEE
LERIKTVFRNQLKAVDSSLPVPF
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttttccagcgcaccgccaaggatgggaacgagttgggcgacctgctcgaaccg
gaaaagaagccgcgcaaggcagcgtccgaacgcgctgacggcaaggacctgttgcccggc
ataggcgccagcctactgggcgtggcggccgccggcgccctgctctggttcggcgtcttc
ggcggcgctggtgaggcgcagcagcgccagttggacgcggcctgggccgaaggccaggcc
ggcgccttgcgccaggccttgcagcaactcgccgccgacacccgcgccgccgcggccagc
cccctcgccctcgaagccctgcaaagcggcgacgccgcccgcatcgaggccgcccagcgc
agcctgctggcctgggacggcgtggtcgatgcccacctgaacgcgcccggccaggccgcc
caggacaacgacagccccggcccggtcagcttcgccgccctggatatcctgcaccgggtg
gaaagtggccagaacgtcgccgccgaagcctacaaggtcggccagcgctggctgctgtac
agcgccgcgccggtgcgcggcgccgaccagagcctgcaaggcacgctgctgctggcggtc
gacctgcaacggctgctgcgcgccctgccgcccttgccgggcgatgccggccaggtacaa
ctggtccagcagttctccggcgcaccggcccaggtgctgctgcaacgcggtacgccggcg
ccgggcaagggtgcgcaagcgctggacagcggcaatccgaactggaaactgaactacacg
cccggcagcgtcgcttcgacccaggcctcgccgctgctgctggcactcgcggcgctgctg
gcgctgctcggcggcatcctcggcacctacctcacccgttcgtcgctgttgcgccgcctg
catcaggatgtcctgaccctcggtcagtatcttcaggaactcggcgggcaacgcactgcc
aaaccccctgtgcctagcctgccgggcttcgccccgctgatccaggcattggcccgccag
ccgcggcgcaagccggagccgaccagcgtgcccagccctgccaaggcagcgccggtggcg
aaagcgcctcctcgcgaggagccggcattggcagatccgttgttccagaacaccgacatt
ctggatatcgacattctcgatgaagaccaggacctcctgggattggagcaaacccccatc
atgagcactgcaaaagcaccgacgctgcccgccagcatcttccgcgcctacgacatccgt
ggcgtggtaggcgataccctcaccgccgagaccgcctactggatcggtcgcgccatcggc
tcggaaagcctcgcccgcggcgaaccgtgcgtcgctgtcggccgcgatggccgcctgtcc
ggtcccgagctggtcaagcagctgatccagggcctggtggactgcggttgccaggtcagc
gacgtgggcatggtgcctaccccggtgctgtactacgcggccaacgtgctcgagggcaag
tccggggtgatgctgaccggcagccacaacccgccggactacaacggcttcaagatcgtg
gtcgccggcgagaccctggccaacgagcagatccaggccctgcgcgagcgcatcgagaaa
aacgacctggcatccggcgtcggcagcgtagagcaggtcgacatcctgccgcgctacttc
aagcagatccgcgacgacatcgccatggccaagccgatgaaggtggtggtcgactgcggc
aacggcgtggccggggtgatcgccccgcagttgatcgaggccctgggctgcagcgtgatc
ccgctgtactgcgaggtcgacggcaacttcccgaaccaccatccggacccgggcaagccg
gagaacctgaaggacctgatcgccaaggtcaaggccgagaacgccgacctgggcctggcc
ttcgacggcgacggcgatcgcgtcggcgtggtcaccaataccggtaccatcatctatccg
gaccgtctgctgatgctgttcgccaaggacgtggtctcgcgcaacccgggggccgacatc
atcttcgacgtcaagtgcacccgccgtctgatcgccctgatcagcggctacggcggccgt
ccggtgatgtggaagaccggccactcgctgatcaagaagaagatgaaggaaaccggcgcc
ctgctggctggcgagatgagcggccacgtgttcttcaaggagcgctggttcggcttcgac
gatggcatctacagcgccgcccgcctgctggaaatcctcagccaggatcagcgtgacagc
gagcacgtgttctcggccttcccgagcgacatttccaccccggaaatcaacatcaccgtc
accgaggacagcaagttcgccatcatcgaggcgctgcaacgcgacgcccaatggggcgaa
ggcaacatcaccaccctcgacggcgtgcgggtcgactaccccaaaggctggggcctggta
cgcgcctccaacaccactcccgtgctggtcctgcgcttcgaagcggacaccgaggaagag
ctggagcgcatcaagaccgtcttccgtaaccaactgaaggcagtggattcctcgctgccc
gtgcccttctga

DBGET integrated database retrieval system