KEGG   Pseudomonas aeruginosa M18: PAM18_5542Help
Entry
PAM18_5542        CDS       T01973                                 

Definition
putative aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:paf00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6158057..6158974
Genome map
AA seq 305 aa AA seqDB search
MSTDSPINRVEQVQVDDLACWRIHTAHGEALIAQQGAQLLSYQPHEQPPLVWLSDEAGYR
RGQSVRGGVPVCWPWFGPLERNPQEVRGQVEDGLKAPAHGLVRAVDWEIDDIAEEDGDLC
VSFRLDAPDGLPGWPHPAALRMLFSFGERLTLRLTSENLGSKPLVLSQALHTYFAVSDSR
EIAIEGLEGARYIETLENWEERTQHGAVRVKGELDRIYLGLERDLLIKDPRWERSIHLHA
LDSRSAVVWNPWVDKSRRLSQFADDAWQQMLCIETGRVWDDLMVVAPGRSESFGVQIWSE
PLKRP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgatagcccgatcaaccgcgtcgaacaggtacaggtcgacgacctggcctgc
tggcgcatccacaccgcccatggcgaggcgctgatcgcccagcagggcgcgcaactgctc
agctaccagccccacgaacagccgccgctggtctggctcagcgacgaggccggctaccgg
cgcgggcagtcggtacgcggcggggtgccggtgtgctggccgtggttcggtccgctggag
cgcaacccgcaggaagtccgcggccaggtggaagatggcctgaaggcgcccgcccacggg
ctggtccgggcagtcgactgggaaatcgacgacatcgccgaggaggacggcgacctctgc
gtcagcttccgcctcgacgcccccgatggcctccccggctggccgcacccggcggcgctg
cgcatgctgttcagcttcggcgagcgcctgaccctgcgactcaccagcgagaacctcggc
agcaagccgctggtgctcagccaggcactgcacacctacttcgcggtcagcgacagccgc
gagatcgccatcgagggcctggaaggcgcgcgctacatcgagaccctggagaactgggaa
gaacgcactcagcacggcgcggtacgggtcaagggcgaactggatcgcatctacctcggt
ctcgaacgcgacctgctgatcaaggacccgcgctgggaacgcagcatccacctgcacgcc
ctcgactcgcgctcggcggtggtctggaacccctgggtggacaagtcccggcgtctctcg
cagttcgccgacgacgcctggcagcagatgctctgcatcgagaccgggcgggtctgggac
gacctcatggtggtcgcccccgggcgcagcgaaagctttggcgtgcagatctggagcgag
ccgctgaaacgaccctga

DBGET integrated database retrieval system