KEGG   Pseudomonas aeruginosa M18: PAM18_5547Help
Entry
PAM18_5547        CDS       T01973                                 

Gene name
adhA
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PAM18_5547 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAM18_5547 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    PAM18_5547 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PAM18_5547 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PAM18_5547 (adhA)
   00626 Naphthalene degradation
    PAM18_5547 (adhA)
Enzymes [BR:paf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PAM18_5547 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6161962..6162990
Genome map
AA seq 342 aa AA seqDB search
MTLPQTMKAAVVHAYGAPLRIEEVKVPLPGPGQVLVKIEASGVCHTDLHAAEGDWPVKPP
LPFIPGHEGVGYVAAVGSGVTRVKEGDRVGIPWLYTACGCCEHCLTGWETLCESQQNTGY
SVNGGYAEYVLADPNYVGILPKNVEFAEIAPILCAGVTVYKGLKQTNARPGQWVAISGIG
GLGHVAVQYARAMGLHVAAIDIDDAKLELARKLGASLTVNARQEDPVEVLQRDIGGAHGV
LVTAVSNSAFGQAIGMARRGGTIALVGLPPGDFPTPIFDVVLKGLHIAGSIVGTRADLQE
ALDFAGEGLVKATIHPGKLDDINQILDQMRAGQIEGRIVLEM
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgccacagaccatgaaagccgcggtcgtgcacgcctacggcgcgccgctgcgg
atcgaggaagtcaaggttccgctgcccggccccgggcaggtactggtgaagatcgaagcc
tccggcgtctgccacaccgacctgcacgccgccgagggcgactggccggtgaagccgccg
ttgccgttcattcccggtcacgaaggcgtcggctacgtcgccgcggtgggcagcggagtg
acccgggtgaaggaaggcgaccgggtcggcatcccctggctgtacaccgcctgcggctgc
tgcgagcactgcctgaccggctgggagaccctctgcgagagccagcagaacaccggctac
tcggtgaacggcggctatgccgaatacgtattggccgacccgaactacgtcggaattctg
ccgaaaaacgtcgaattcgctgaaatcgcgccgatcctctgcgccggcgtcaccgtctac
aaggggctcaagcagaccaacgcgcgccccggccagtgggtggcgatctccggcatcggt
ggcctcggccacgtcgccgtgcagtacgccagggccatgggcctgcacgtcgccgccatc
gacatcgacgacgccaagctggaactggcgcgcaagctcggtgccagcctgacggtcaac
gcccggcaggaagacccggtggaggtgctccagcgcgacatcggcggcgcccacggggtg
ctggtcaccgcggtatccaacagcgccttcggccaggccatcggcatggcgcgccgcggc
ggcaccatcgccctggtcggcctgccgccgggtgacttcccgacgccgatcttcgacgtg
gtgctcaagggcctgcacatcgccggctcaatcgtcggcacccgcgcggaccttcaggaa
gccctcgactttgccggcgaaggcctggtcaaggcgaccatccatccgggcaagctggac
gacatcaaccagatcctcgaccagatgcgcgccgggcagatcgaggggcgcatcgtcctt
gagatgtga

DBGET integrated database retrieval system